Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281646_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using ABCA1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit ABCA1 Polyclonal Antibody | anti-ABCA1 antibody

ABCA1 Rabbit pAb

Gene Names
ABCA1; TGD; ABC1; CERP; ABC-1; HDLDT1
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
ABCA1, Antibody; ABCA1 Rabbit pAb; ABCA1; ABC-1; ABC1; CERP; HDLDT1; TGD; anti-ABCA1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
IQYRFFIRPRPVNAKLSPLNDEDEDVRRERQRILDGGGQNDILEIKELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHSMEECEALCTRMAIMVNG
Applicable Applications for anti-ABCA1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1870-2120 of human ABCA1 (NP_005493.2).
Cellular Location
Membrane, Multi-pass membrane protein
Positive Samples
Mouse brain, Rat brain, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using ABCA1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281646_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using ABCA1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat ovary using ABCA1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281646_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat ovary using ABCA1 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse kidney using ABCA1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281646_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse kidney using ABCA1 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ABCA1 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281646_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ABCA1 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of extracts of Rat brain, using ABCA1 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA281646_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of Rat brain, using ABCA1 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-ABCA1 antibody
Background: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesteral efflux pump in the cellular lipid removal pathway. Mutations in this gene have been associated with Tangier's disease and familial high-density lipoprotein deficiency.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
19
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
254,302 Da
NCBI Official Full Name
ATP-binding cassette sub-family A member 1
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family A (ABC1), member 1
NCBI Official Symbol
ABCA1
NCBI Official Synonym Symbols
TGD; ABC1; CERP; ABC-1; HDLDT1
NCBI Protein Information
ATP-binding cassette sub-family A member 1; membrane-bound; ATP-binding cassette transporter A1; cholesterol efflux regulatory protein
UniProt Protein Name
ATP-binding cassette sub-family A member 1
UniProt Gene Name
ABCA1
UniProt Synonym Gene Names
ABC1; CERP; ABC-1
UniProt Entry Name
ABCA1_HUMAN

Similar Products

Product Notes

The ABCA1 abca1 (Catalog #AAA281646) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABCA1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ABCA1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ABCA1 abca1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IQYRFFIRPR PVNAKLSPLN DEDEDVRRER QRILDGGGQN DILEIKELTK IYRRKRKPAV DRICVGIPPG ECFGLLGVNG AGKSSTFKML TGDTTVTRGD AFLNKNSILS NIHEVHQNMG YCPQFDAITE LLTGREHVEF FALLRGVPEK EVGKVGEWAI RKLGLVKYGE KYAGNYSGGN KRKLSTAMAL IGGPPVVFLD EPTTGMDPKA RRFLWNCALS VVKEGRSVVL TSHSMEECEA LCTRMAIMVN G. It is sometimes possible for the material contained within the vial of "ABCA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.