Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282204_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and ABCA6 knockdown (KD) 293T cells, using ABCA6 antibody at 1:1470 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Rabbit ABCA6 Polyclonal Antibody | anti-ABCA6 antibody

[KD Validated] ABCA6 Rabbit pAb

Gene Names
CTNND1; CAS; p120; CTNND; P120CAS; P120CTN; p120(CAS); p120(CTN)
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
ABCA6, Antibody; [KD Validated] ABCA6 Rabbit pAb; ABCA6; EST155051; Abca6; anti-ABCA6 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
ILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQKI
Applicable Applications for anti-ABCA6 antibody
WB (Western Blot)
Positive Samples
293T, RAW264.7, Mouse liver, Rat liver
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1518-1617 of human ABCA6 (NP_525023.2).
Cellular Location
Membrane, Multi-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts from wild type(WT) and ABCA6 knockdown (KD) 293T cells, using ABCA6 antibody at 1:1470 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA282204_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and ABCA6 knockdown (KD) 293T cells, using ABCA6 antibody at 1:1470 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ABCA6 antibody at 1:1470 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA282204_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ABCA6 antibody at 1:1470 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-ABCA6 antibody
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
108,170 Da
NCBI Official Full Name
catenin delta-1 isoform 1ABC
NCBI Official Synonym Full Names
catenin (cadherin-associated protein), delta 1
NCBI Official Symbol
CTNND1
NCBI Official Synonym Symbols
CAS; p120; CTNND; P120CAS; P120CTN; p120(CAS); p120(CTN)
NCBI Protein Information
catenin delta-1; p120 catenin; cadherin-associated Src substrate
UniProt Protein Name
Catenin delta-1
UniProt Gene Name
CTNND1
UniProt Synonym Gene Names
KIAA0384; CAS; p120(ctn)
UniProt Entry Name
CTND1_HUMAN

Similar Products

Product Notes

The ABCA6 ctnnd1 (Catalog #AAA282204) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] ABCA6 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ABCA6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ABCA6 ctnnd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ILEASAGAIQ NLCAGRWTYG RYIRSALRQE KALSAIADLL TNEHERVVKA ASGALRNLAV DARNKELIGK HAIPNLVKNL PGGQQNSSWN FSEDTVISIL NTINEVIAEN LEAAKKLRET QGIEKLVLIN KSGNRSEKEV RAAALVLQTI WGYKELRKPL EKEGWKKSDF QVNLNNASRS QSSHSYDDST LPLIDRNQKS DKKPDREEIQ MSNMGSNTKS LDNNYSTPNE RGDHNRTLDR SGDLGDMEPL KGTTPLMQKI. It is sometimes possible for the material contained within the vial of "ABCA6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.