Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28279_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse lung using ABCB7 antibody at dilution of 1:100 (40x lens).)

Rabbit ABCB7 Polyclonal Antibody | anti-ABCB7 antibody

ABCB7 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
ABCB7; ABC7; ASAT; Atm1p; EST140535
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
ABCB7, Antibody; ABCB7 Polyclonal Antibody; ABC7; ASAT; Atm1p; EST140535; anti-ABCB7 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
AIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEIVNSVKGCGNCSC
Sequence Length
752
Applicable Applications for anti-ABCB7 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human ABCB7
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion inner membrane, Multi-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using ABCB7 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28279_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse lung using ABCB7 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse heart using ABCB7 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28279_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse heart using ABCB7 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat heart using ABCB7 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28279_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat heart using ABCB7 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human gastric cancer using ABCB7 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28279_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human gastric cancer using ABCB7 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human liver using ABCB7 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28279_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human liver using ABCB7 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ABCB7 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA28279_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ABCB7 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-ABCB7 antibody
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a half-transporter involved in the transport of heme from the mitochondria to the cytosol. With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis. Mutations in this gene have been associated with mitochondrial iron accumulation and isodicentric (X)(q13) and sideroblastic anemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-ABCB7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
22
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 78kDa; 82kDa
Observed: 83kDa
NCBI Official Full Name
ATP-binding cassette sub-family B member 7, mitochondrial isoform 2
NCBI Official Synonym Full Names
ATP binding cassette subfamily B member 7
NCBI Official Symbol
ABCB7
NCBI Official Synonym Symbols
ABC7; ASAT; Atm1p; EST140535
NCBI Protein Information
ATP-binding cassette sub-family B member 7, mitochondrial
UniProt Protein Name
ATP-binding cassette sub-family B member 7, mitochondrial
UniProt Gene Name
ABCB7
UniProt Synonym Gene Names
ABC7; ABC transporter 7 protein

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ABCB7 abcb7 (Catalog #AAA28279) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABCB7 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ABCB7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the ABCB7 abcb7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AIVGGSGSGK STIVRLLFRF YEPQKGSIYL AGQNIQDVSL ESLRRAVGVV PQDAVLFHNT IYYNLLYGNI SASPEEVYAV AKLAGLHDAI LRMPHGYDTQ VGERGLKLSG GEKQRVAIAR AILKDPPVIL YDEATSSLDS ITEETILGAM KDVVKHRTSI FIAHRLSTVV DADEIIVLDQ GKVAERGTHH GLLANPHSIY SEMWHTQSSR VQNHDNPKWE AKKENISKEE ERKKLQEEIV NSVKGCGNCS C. It is sometimes possible for the material contained within the vial of "ABCB7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.