Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199296_WB11.jpg WB (Western Blot) (WB Suggested Anti-ABCC9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateABCC9 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit ABCC9 Polyclonal Antibody | anti-ABCC9 antibody

ABCC9 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ABCC9; SUR2; ABC37; CANTU; CMD1O; ATFB12
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ABCC9, Antibody; ABCC9 antibody - middle region; anti-ABCC9 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
Sequence Length
1549
Applicable Applications for anti-ABCC9 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ABCC9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ABCC9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateABCC9 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA199296_WB11.jpg WB (Western Blot) (WB Suggested Anti-ABCC9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateABCC9 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Lanes:1: 10ug SUR1 KO mouse ventricle lysate, 2: 10ug WT mouse ventricle lysate, 3: 0.1ug SUR1 overexpressing mouse ventricle lysate, 4: 10ug cannine ventricle lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:ABCC9Submitted by:Haixia Zhang)

product-image-AAA199296_WB13.jpg WB (Western Blot) (Lanes:1: 10ug SUR1 KO mouse ventricle lysate, 2: 10ug WT mouse ventricle lysate, 3: 0.1ug SUR1 overexpressing mouse ventricle lysate, 4: 10ug cannine ventricle lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:ABCC9Submitted by:Haixia Zhang)

WB (Western Blot)

(Host: RabbitTarget Name: ABCC9Sample Tissue: Human PANC1Antibody Dilution: 1.0ug/ml)

product-image-AAA199296_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: ABCC9Sample Tissue: Human PANC1Antibody Dilution: 1.0ug/ml)
Related Product Information for anti-ABCC9 antibody
This is a rabbit polyclonal antibody against ABCC9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion.
Product Categories/Family for anti-ABCC9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
174kDa
NCBI Official Full Name
ATP-binding cassette sub-family C member 9 isoform SUR2A
NCBI Official Synonym Full Names
ATP binding cassette subfamily C member 9
NCBI Official Symbol
ABCC9
NCBI Official Synonym Symbols
SUR2; ABC37; CANTU; CMD1O; ATFB12
NCBI Protein Information
ATP-binding cassette sub-family C member 9
UniProt Protein Name
ATP-binding cassette sub-family C member 9
UniProt Gene Name
ABCC9
UniProt Synonym Gene Names
SUR2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ABCC9 abcc9 (Catalog #AAA199296) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABCC9 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ABCC9 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ABCC9 abcc9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVVTEGGENF SVGQRQLFCL ARAFVRKSSI LIMDEATASI DMATENILQK. It is sometimes possible for the material contained within the vial of "ABCC9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.