Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199294_WB10.jpg WB (Western Blot) (WB Suggested Anti-ABCD3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

Rabbit ABCD3 Polyclonal Antibody | anti-ABCD3 antibody

ABCD3 antibody - N-terminal region

Gene Names
ABCD3; ZWS2; ABC43; CBAS5; PMP70; PXMP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ABCD3, Antibody; ABCD3 antibody - N-terminal region; anti-ABCD3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD
Sequence Length
659
Applicable Applications for anti-ABCD3 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 77%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ABCD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ABCD3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

product-image-AAA199294_WB10.jpg WB (Western Blot) (WB Suggested Anti-ABCD3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

WB (Western Blot)

(Host: RabbitTarget Name: ABCD3Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlABCD3 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA199294_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: ABCD3Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlABCD3 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: ABCD3Sample Type: Human HelaAntibody Dilution: 1.0ug/mlABCD3 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA199294_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ABCD3Sample Type: Human HelaAntibody Dilution: 1.0ug/mlABCD3 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: ABCD3Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlABCD3 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA199294_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: ABCD3Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlABCD3 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-ABCD3 antibody
This is a rabbit polyclonal antibody against ABCD3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, M
Product Categories/Family for anti-ABCD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
ATP-binding cassette sub-family D member 3 isoform a
NCBI Official Synonym Full Names
ATP binding cassette subfamily D member 3
NCBI Official Symbol
ABCD3
NCBI Official Synonym Symbols
ZWS2; ABC43; CBAS5; PMP70; PXMP1
NCBI Protein Information
ATP-binding cassette sub-family D member 3
UniProt Protein Name
ATP-binding cassette sub-family D member 3
UniProt Gene Name
ABCD3
UniProt Synonym Gene Names
PMP70; PXMP1; PMP70
UniProt Entry Name
ABCD3_HUMAN

Similar Products

Product Notes

The ABCD3 abcd3 (Catalog #AAA199294) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABCD3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ABCD3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ABCD3 abcd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKYGLNELKL CFRVRLTKYL YEEYLQAFTY YKMGNLDNRI ANPDQLLTQD. It is sometimes possible for the material contained within the vial of "ABCD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.