Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199291_WB13.jpg WB (Western Blot) (WB Suggested Anti-Abcf1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Brain)

Rabbit Abcf1 Polyclonal Antibody | anti-ABCF1 antibody

Abcf1 antibody - C-terminal region

Gene Names
Abcf1; Abc50
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunoprecipitation
Purity
Affinity Purified
Synonyms
Abcf1, Antibody; Abcf1 antibody - C-terminal region; anti-ABCF1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQDPPELLKRPREYTVRFT
Sequence Length
839
Applicable Applications for anti-ABCF1 antibody
WB (Western Blot), IP (Immunoprecipitation)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Abcf1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Brain)

product-image-AAA199291_WB13.jpg WB (Western Blot) (WB Suggested Anti-Abcf1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Brain)

IP (Immunoprecipitation)

(Researcher: Dr. Joanna Stewart, Centre for Biological Sciences, University of SouthamptonApplication: IPSpecies+tissue/cell type: 1: 500 ug HEK293 cell lysate transfected with ABCF1 wt, 2: 500 ug HEK293 cell lysate untransfected, 3: 500 ug HEK293 cell lysate transfected with mutABCF1Amount of IP antibody: 1ugPrimary antibody dilution: 1:1000Secondary antibody: Anti-rabbit-Alexa Fluor 680Secondary antibody dilution:1:20000)

product-image-AAA199291_IP15.jpg IP (Immunoprecipitation) (Researcher: Dr. Joanna Stewart, Centre for Biological Sciences, University of SouthamptonApplication: IPSpecies+tissue/cell type: 1: 500 ug HEK293 cell lysate transfected with ABCF1 wt, 2: 500 ug HEK293 cell lysate untransfected, 3: 500 ug HEK293 cell lysate transfected with mutABCF1Amount of IP antibody: 1ugPrimary antibody dilution: 1:1000Secondary antibody: Anti-rabbit-Alexa Fluor 680Secondary antibody dilution:1:20000)
Related Product Information for anti-ABCF1 antibody
This is a rabbit polyclonal antibody against Abcf1. It was validated on Western Blot

Target Description: Abcf1 is required for efficient Cap- and IRES-mediated mRNA translation initiation. Abcf1 is not involved in the ribosome biogenesis.
Product Categories/Family for anti-ABCF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
ATP-binding cassette sub-family F member 1
NCBI Official Synonym Full Names
ATP binding cassette subfamily F member 1
NCBI Official Symbol
Abcf1
NCBI Official Synonym Symbols
Abc50
NCBI Protein Information
ATP-binding cassette sub-family F member 1
UniProt Protein Name
ATP-binding cassette sub-family F member 1
UniProt Gene Name
Abcf1
UniProt Synonym Gene Names
Abc50

Similar Products

Product Notes

The ABCF1 abcf1 (Catalog #AAA199291) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Abcf1 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Abcf1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IP (Immunoprecipitation). Researchers should empirically determine the suitability of the ABCF1 abcf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGKSTKQAEK QTKEVLTRKQ QKCRRKNQDE ESQDPPELLK RPREYTVRFT. It is sometimes possible for the material contained within the vial of "Abcf1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.