Rabbit ABHD11 Polyclonal Antibody | anti-ABHD11 antibody
ABHD11 Antibody - N-terminal region
Gene Names
ABHD11; PP1226; WBSCR21
Reactivity
HumanPredicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
ABHD11, Antibody; ABHD11 Antibody - N-terminal region; anti-ABHD11 antibody
Host
Rabbit
Reactivity
Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLG
Sequence Length
315
Applicable Applications for anti-ABHD11 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 92%; Zebrafish: 92%
Immunogen
The immunogen for Anti-ABHD11 antibody is: synthetic peptide directed towards the N-terminal region of Human ABHDB
Protein Size
315 amino acids
Protein Interactions
SUMO1; UBC; NEDD8; MDM2; APP;
Preparation and Storage
For short term use, store at 2-8°C. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-ABHD11 antibody
This is a rabbit polyclonal antibody against ABHDB. It was validated on Western Blot
Target Description: This gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Target Description: This gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Product Categories/Family for anti-ABHD11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
protein ABHD11 isoform 8
NCBI Official Synonym Full Names
abhydrolase domain containing 11
NCBI Official Symbol
ABHD11
NCBI Official Synonym Symbols
PP1226; WBSCR21
NCBI Protein Information
protein ABHD11
UniProt Protein Name
Alpha/beta hydrolase domain-containing protein 11
UniProt Gene Name
ABHD11
UniProt Synonym Gene Names
WBSCR21; Abhydrolase domain-containing protein 11
UniProt Entry Name
ABHDB_HUMAN
Similar Products
Product Notes
The ABHD11 abhd11 (Catalog #AAA201034) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABHD11 Antibody - N-terminal region reacts with Human Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ABHD11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ABHD11 abhd11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FNSIAKILAQ QTGRRVLTVD ARNHGDSPHS PDMSYEIMSQ DLQDLLPQLG. It is sometimes possible for the material contained within the vial of "ABHD11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
