WB (Western Blot)
(WB Suggested Anti-ABHD5 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateABHD5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Rabbit ABHD5 Polyclonal Antibody | anti-ABHD5 antibody
ABHD5 antibody - C-terminal region
Gene Names
ABHD5; CGI58; IECN2; NCIE2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ABHD5, Antibody; ABHD5 antibody - C-terminal region; anti-ABHD5 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK
Sequence Length
349
Applicable Applications for anti-ABHD5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ABHD5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ABHD5 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateABHD5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
WB (Western Blot)
(WB Suggested Anti-ABHD5 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateABHD5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
IHC (Immunohistochemistry)
(Human Colon)
IHC (Immunohistochemistry)
(Human Colon)
Related Product Information for anti-ABHD5 antibody
This is a rabbit polyclonal antibody against ABHD5. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
Target Description: ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
Product Categories/Family for anti-ABHD5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
1-acylglycerol-3-phosphate O-acyltransferase ABHD5 isoform a
NCBI Official Synonym Full Names
abhydrolase domain containing 5
NCBI Official Symbol
ABHD5
NCBI Official Synonym Symbols
CGI58; IECN2; NCIE2
NCBI Protein Information
1-acylglycerol-3-phosphate O-acyltransferase ABHD5
UniProt Protein Name
1-acylglycerol-3-phosphate O-acyltransferase ABHD5
UniProt Gene Name
ABHD5
UniProt Synonym Gene Names
NCIE2
Similar Products
Product Notes
The ABHD5 abhd5 (Catalog #AAA199122) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABHD5 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ABHD5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ABHD5 abhd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVIFGARSCI DGNSGTSIQS LRPHSYVKTI AILGAGHYVY ADQPEEFNQK. It is sometimes possible for the material contained within the vial of "ABHD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.