Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281617_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of Neuro-2a cells, using ABI1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

Rabbit ABI1 Polyclonal Antibody | anti-ABI1 antibody

ABI1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
ABI1; E3B1; ABI-1; ABLBP4; NAP1BP; SSH3BP; SSH3BP1
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
ABI1, Antibody; ABI1 Rabbit pAb; ABI1; ABI-1; ABLBP4; E3B1; NAP1BP; SSH3BP; SSH3BP1; anti-ABI1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQR
Applicable Applications for anti-ABI1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 180-230 of human ABI1 (NP_001012770).
Cellular Location
Cell junction, Cell projection, Cytoplasm, Nucleus, cytoskeleton, filopodium, growth cone, lamellipodium, postsynaptic cell membrane, postsynaptic density, synapse
Positive Samples
Neuro-2a, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of Neuro-2a cells, using ABI1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

product-image-AAA281617_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of Neuro-2a cells, using ABI1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of Rat brain cells, using ABI1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281617_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of Rat brain cells, using ABI1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-ABI1 antibody
Background: This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
53,912 Da
NCBI Official Full Name
Abl interactor 1
NCBI Official Synonym Full Names
abl-interactor 1
NCBI Official Symbol
ABI1
NCBI Official Synonym Symbols
E3B1; ABI-1; ABLBP4; NAP1BP; SSH3BP; SSH3BP1
NCBI Protein Information
abl interactor 1; Abelson interactor 1; nap1 binding protein; abl-binding protein 4; interactor protein AblBP4; Abl-interactor protein 1 long; eps8 SH3 domain-binding protein; spectrin SH3 domain-binding protein 1
UniProt Protein Name
Abl interactor 1
UniProt Gene Name
ABI1
UniProt Synonym Gene Names
SSH3BP1; Abi-1; AblBP4; Eps8-binding protein; Nap1BP
UniProt Entry Name
ABI1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ABI1 abi1 (Catalog #AAA281617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABI1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ABI1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ABI1 abi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PMSGRGTLGR NTPYKTLEPV KPPTVPNDYM TSPARLGSQH SPGRTASLNQ R. It is sometimes possible for the material contained within the vial of "ABI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.