WB (Western Blot)
(WB Suggested Anti-ABP1 AntibodyTitration: 1 ug/mlPositive Control: HepG2 cell lysate)
Rabbit ABP1 Polyclonal Antibody | anti-AOC1 antibody
ABP1 antibody - C-terminal region
Gene Names
AOC1; ABP; DAO; KAO; ABP1; DAO1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ABP1, Antibody; ABP1 antibody - C-terminal region; anti-AOC1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF
Sequence Length
751
Applicable Applications for anti-AOC1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ABP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ABP1 AntibodyTitration: 1 ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-ABP1 AntibodyTitration: 1 ug/mlPositive Control: HepG2 cell lysate)
IHC (Immunohistochemistry)
(Rabbit Anti-ABP1 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-ABP1 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-AOC1 antibody
This is a rabbit polyclonal antibody against ABP1. It was validated on Western Blot and immunohistochemistry
Target Description: ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.
Target Description: ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.
Product Categories/Family for anti-AOC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
amiloride-sensitive amine oxidase
NCBI Official Synonym Full Names
amine oxidase copper containing 1
NCBI Official Symbol
AOC1
NCBI Official Synonym Symbols
ABP; DAO; KAO; ABP1; DAO1
NCBI Protein Information
amiloride-sensitive amine oxidase [copper-containing]
UniProt Protein Name
Amiloride-sensitive amine oxidase [copper-containing]
UniProt Gene Name
AOC1
UniProt Synonym Gene Names
ABP1; DAO1; DAO; Diamine oxidase; KAO
Similar Products
Product Notes
The AOC1 aoc1 (Catalog #AAA199016) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABP1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ABP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the AOC1 aoc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QFLHNNENIE NEDLVAWVTV GFLHIPHSED IPNTATPGNS VGFLLRPFNF. It is sometimes possible for the material contained within the vial of "ABP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.