Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46631_IHC10.jpg IHC (Immunohistochemistry) (ABR was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit ABR Polyclonal Antibody | anti-ABR antibody

Anti-ABR Antibody

Gene Names
ABR; MDB
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
ABR, Antibody; Anti-ABR Antibody; abr; Active BCR related gene; MDB; Q12979; Active breakpoint cluster region-related protein; active BCR-related; anti-ABR antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
822
Applicable Applications for anti-ABR antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ABR (370-407aa HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL), different from the related mouse sequence by one amino acid.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(ABR was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46631_IHC10.jpg IHC (Immunohistochemistry) (ABR was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(ABR was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46631_IHC11.jpg IHC (Immunohistochemisry) (ABR was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(ABR was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46631_IHC13.jpg IHC (Immunohiostchemistry) (ABR was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of ABR expression in rat brain extract (lane 1) and mouse brain extract (lane 2). ABR at 98KD was detected using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46631_WB15.jpg WB (Western Blot) (Western blot analysis of ABR expression in rat brain extract (lane 1) and mouse brain extract (lane 2). ABR at 98KD was detected using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-ABR antibody
Rabbit IgG polyclonal antibody for Active breakpoint cluster region-related protein (ABR) detection.
Background: This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.
References
1. Heisterkamp, N., Kaartinen, V., van Soest, S., Bokoch, G. M., Groffen, J. Human ABR encodes a protein with GAP-rac activity and homology to the DBL nucleotide exchange factor domain. J. Biol. Chem. 268: 16903-16906, 1993.
2. Heisterkamp, N., Morris, C., Groffen, J. ABR, an active BCR-related gene. Nucleic Acids Res. 17: 8821-8831, 1989.
3. McDonald, J. D., Daneshvar, L., Willert, J. R., Matsumura, K., Waldman, F., Cogen, P. H. Physical mapping of chromosome 17p13.3 in the region of a putative tumor suppressor gene important in medulloblastoma. Genomics 23: 229-232, 1994.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
29
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92,425 Da
NCBI Official Full Name
active breakpoint cluster region-related protein isoform b
NCBI Official Synonym Full Names
active BCR-related
NCBI Official Symbol
ABR
NCBI Official Synonym Symbols
MDB
NCBI Protein Information
active breakpoint cluster region-related protein
UniProt Protein Name
Active breakpoint cluster region-related protein
UniProt Gene Name
ABR
UniProt Entry Name
ABR_HUMAN

Similar Products

Product Notes

The ABR abr (Catalog #AAA46631) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ABR Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's ABR can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ABR abr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.