Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46813_IHC13.jpg IHC (Immunohiostchemistry) (ACAA2 was detected in paraffin-embedded sections of human intestianl cancer tissues using rabbit anti- ACAA2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit ACAA2 Polyclonal Antibody | anti-ACAA2 antibody

Anti-ACAA2 Antibody

Gene Names
ACAA2; DSAEC
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
ACAA2, Antibody; Anti-ACAA2 Antibody; ACAA 2; Acaa2; Beta ketothiolase; Beta-ketothiolase; DSAEC; P42765; 3-ketoacyl-CoA thiolase, mitochondrial; acetyl-CoA acyltransferase 2; anti-ACAA2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
397
Applicable Applications for anti-ACAA2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ACAA2 (207-242aa EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(ACAA2 was detected in paraffin-embedded sections of human intestianl cancer tissues using rabbit anti- ACAA2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46813_IHC13.jpg IHC (Immunohiostchemistry) (ACAA2 was detected in paraffin-embedded sections of human intestianl cancer tissues using rabbit anti- ACAA2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of ACAA2 expression in rat lung extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). ACAA2 at 42KD was detected using rabbit anti- ACAA2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46813_WB15.jpg WB (Western Blot) (Western blot analysis of ACAA2 expression in rat lung extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). ACAA2 at 42KD was detected using rabbit anti- ACAA2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-ACAA2 antibody
Rabbit IgG polyclonal antibody for 3-ketoacyl-CoA thiolase, mitochondrial(ACAA2) detection.
Background: 3-Ketoacyl-CoA thiolase, mitochondrial, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene. The ACAA2 gene encodes a 41.9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides. The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. Additionally, ACAA2 has been shown to be a functional BNIP3 binding partner, which provides a possible link between fatty acid metabolism and cell apoptosis.
References
1. Cao W, Liu N, Tang S, Bao L, Shen L, Yuan H, Zhao X, Lu H (Jun 2008). "Acetyl-Coenzyme A acyltransferase 2 attenuates the apoptotic effects of BNIP3 in two human cell lines". Biochimica et Biophysica Acta 1780 (6): 873-80.
2. Kathiresan S, Melander O, Guiducci C, Surti A, Burtt NP, Rieder MJ, Cooper GM, Roos C, Voight BF, Havulinna AS, Wahlstrand B, Hedner T, Corella D, Tai ES, Ordovas JM, Berglund G, Vartiainen E, Jousilahti P, Hedblad B, Taskinen MR, Newton-Cheh C, Salomaa V, Peltonen L, Groop L, Altshuler DM, Orho-Melander M (Feb 2008). "Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans". Nature Genetics 40 (2): 189-97.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,924 Da
NCBI Official Full Name
3-ketoacyl-CoA thiolase, mitochondrial
NCBI Official Synonym Full Names
acetyl-CoA acyltransferase 2
NCBI Official Symbol
ACAA2
NCBI Official Synonym Symbols
DSAEC
NCBI Protein Information
3-ketoacyl-CoA thiolase, mitochondrial
UniProt Protein Name
3-ketoacyl-CoA thiolase, mitochondrial
UniProt Gene Name
ACAA2

Similar Products

Product Notes

The ACAA2 acaa2 (Catalog #AAA46813) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ACAA2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACAA2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ACAA2 acaa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACAA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.