Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200343_WB13.jpg WB (Western Blot) (WB Suggested Anti-ACAT1 Antibody Titration: 1 ug/mlPositive Control: Fetal heart lysate)

Rabbit ACAT1 Polyclonal Antibody | anti-ACAT1 antibody

ACAT1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ACAT1; T2; MAT; ACAT; THIL
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ACAT1, Antibody; ACAT1 antibody - middle region; anti-ACAT1 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL
Sequence Length
427
Applicable Applications for anti-ACAT1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Protein Size (#AA)
427 amino acids
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACAT1
Blocking Peptide
For anti-ACAT (MBS3211571) antibody is Catalog# (MBS3236520)
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACAT1 Antibody Titration: 1 ug/mlPositive Control: Fetal heart lysate)

product-image-AAA200343_WB13.jpg WB (Western Blot) (WB Suggested Anti-ACAT1 Antibody Titration: 1 ug/mlPositive Control: Fetal heart lysate)

IHC (Immunohistochemistry)

(Human Heart)

product-image-AAA200343_IHC15.jpg IHC (Immunohistochemistry) (Human Heart)
Related Product Information for anti-ACAT1 antibody
This is a rabbit polyclonal antibody against ACAT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.This gene encodes a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. This gene spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
38
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
acetyl-CoA acetyltransferase, mitochondrial
NCBI Official Synonym Full Names
acetyl-CoA acetyltransferase 1
NCBI Official Symbol
ACAT1
NCBI Official Synonym Symbols
T2; MAT; ACAT; THIL
NCBI Protein Information
acetyl-CoA acetyltransferase, mitochondrial
UniProt Protein Name
Sterol O-acyltransferase 1
UniProt Gene Name
SOAT1
UniProt Synonym Gene Names
ACACT; ACACT1; ACAT; ACAT1; SOAT; STAT; ACAT-1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACAT1 soat1 (Catalog #AAA200343) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACAT1 antibody - middle region reacts with Tested: Human Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACAT1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ACAT1 soat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SYTRSKAAWE AGKFGNEVIP VTVTVKGQPD VVVKEDEEYK RVDFSKVPKL. It is sometimes possible for the material contained within the vial of "ACAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.