Rabbit Acetyl Coenzyme A Carboxylase/ACACB Polyclonal Antibody | anti-ACACB antibody
Anti-Acetyl Coenzyme A Carboxylase/ACACB Antibody
Gene Names
ACACB; ACC2; ACCB; HACC275
Reactivity
Human, Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Acetyl Coenzyme A Carboxylase/ACACB, Antibody; Anti-Acetyl Coenzyme A Carboxylase/ACACB Antibody; Acetyl-CoA carboxylase 2; ACC-beta; Biotin carboxylase; ACACB; ACC2, ACCB ; anti-ACACB antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
2458
Applicable Applications for anti-ACACB antibody
FCM/FACS (Flow Cytometry), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Related Product Information for anti-ACACB antibody
Description: Rabbit IgG polyclonal antibody for Acetyl Coenzyme A Carboxylase/ACACB detection. Tested with WB, IHC-P, FCM in Human; Mouse; Rat.
Background: Acetyl-CoA carboxylase 2 also known as ACC-beta or ACC2 is an enzyme that in humans is encoded by the ACACB gene. It is mapped to 12q24.11. Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. ACC-beta is thought to control fatty acid oxidation by means of the ability of malonyl-CoA to inhibit carnitine-palmitoyl-CoA transferase I, the rate-limiting step in fatty acid uptake and oxidation by mitochondria. ACC-beta may be involved in the regulation of fatty acid oxidation, rather than fatty acid biosynthesis. There is evidence for the presence of two ACC-beta isoforms.
Background: Acetyl-CoA carboxylase 2 also known as ACC-beta or ACC2 is an enzyme that in humans is encoded by the ACACB gene. It is mapped to 12q24.11. Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. ACC-beta is thought to control fatty acid oxidation by means of the ability of malonyl-CoA to inhibit carnitine-palmitoyl-CoA transferase I, the rate-limiting step in fatty acid uptake and oxidation by mitochondria. ACC-beta may be involved in the regulation of fatty acid oxidation, rather than fatty acid biosynthesis. There is evidence for the presence of two ACC-beta isoforms.
References
1. Widmer J, Fassihi KS, Schlichter SC, Wheeler KS, Crute BE, King N, Nutile-McMenemy N, Noll WW, Daniel S, Ha J, Kim KH, Witters LA (June 1996). "Identification of a second human acetyl-CoA carboxylase gene". The Biochemical Journal. 316 (Pt 3) (3): 915-22.
2. Corbett JW, Harwood JH (November 2007). "Inhibitors of mammalian acetyl-CoA carboxylase". Recent Patents on Cardiovascular Drug Discovery. 2 (3): 162-80.
3. Olson DP, Pulinilkunnil T, Cline GW, Shulman GI, Lowell BB (April 2010). "Gene knockout of Acc2 has little effect on body weight, fat mass, or food intake". Proceedings of the National Academy of Sciences of the United States of America. 107 (16): 7598-603.
2. Corbett JW, Harwood JH (November 2007). "Inhibitors of mammalian acetyl-CoA carboxylase". Recent Patents on Cardiovascular Drug Discovery. 2 (3): 162-80.
3. Olson DP, Pulinilkunnil T, Cline GW, Shulman GI, Lowell BB (April 2010). "Gene knockout of Acc2 has little effect on body weight, fat mass, or food intake". Proceedings of the National Academy of Sciences of the United States of America. 107 (16): 7598-603.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
acetyl-CoA carboxylase 2
NCBI Official Synonym Full Names
acetyl-CoA carboxylase beta
NCBI Official Symbol
ACACB
NCBI Official Synonym Symbols
ACC2; ACCB; HACC275
NCBI Protein Information
acetyl-CoA carboxylase 2
UniProt Protein Name
Acetyl-CoA carboxylase 2
UniProt Gene Name
ACACB
UniProt Synonym Gene Names
ACC2; ACCB
Similar Products
Product Notes
The ACACB acacb (Catalog #AAA125469) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Acetyl Coenzyme A Carboxylase/ACACB Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Acetyl Coenzyme A Carboxylase/ACACB can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ACACB acacb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Acetyl Coenzyme A Carboxylase/ACACB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
