Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28437_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using Acetyl-Histone H1.4-K26 at dilution of 1:100. Blue: DAPI for nuclear staining.U2OS cells were treated by TSA (1 uM) at 37 degree C for 18 hours. Blue: DAPI for nuclear staining.)

Rabbit Acetyl-Histone H1.4-K26 Polyclonal Antibody | anti-H1.4-K26 antibody

Acetyl-Histone H1.4-K26 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
Trp53; bbl; bfy; bhy; p44; p53; Tp53
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
Acetyl-Histone H1.4-K26, Antibody; Acetyl-Histone H1.4-K26 Rabbit pAb; H1.4; H1E; H1F4; H1s-4; anti-H1.4-K26 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
PWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVL
Applicable Applications for anti-H1.4-K26 antibody
IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry)
Application Notes
IHC 1:50-1:200
IF/ICC: 1:50-1:200
Immunogen
A synthetic acetylated peptide around K26 of human Histone H14 (NP_005312.1).
Cellular Location
nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using Acetyl-Histone H1.4-K26 at dilution of 1:100. Blue: DAPI for nuclear staining.U2OS cells were treated by TSA (1 uM) at 37 degree C for 18 hours. Blue: DAPI for nuclear staining.)

product-image-AAA28437_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using Acetyl-Histone H1.4-K26 at dilution of 1:100. Blue: DAPI for nuclear staining.U2OS cells were treated by TSA (1 uM) at 37 degree C for 18 hours. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using Acetyl-Histone H1.4-K26 at dilution of 1:100. Blue: DAPI for nuclear staining.NIH/3T3 cells were treated by TSA (1 uM) at 37 degree C for 18 hours. Blue: DAPI for nuclear staining.)

product-image-AAA28437_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using Acetyl-Histone H1.4-K26 at dilution of 1:100. Blue: DAPI for nuclear staining.NIH/3T3 cells were treated by TSA (1 uM) at 37 degree C for 18 hours. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using Acetyl-Histone H1.4-K26 at dilution of 1:100. Blue: DAPI for nuclear staining.C6 cells were treated by TSA (1 uM) at 37 degree C for 18 hours. Blue: DAPI for nuclear staining.)

product-image-AAA28437_IF4.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using Acetyl-Histone H1.4-K26 at dilution of 1:100. Blue: DAPI for nuclear staining.C6 cells were treated by TSA (1 uM) at 37 degree C for 18 hours. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using Acetyl-Histone H1.4-K26 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28437_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using Acetyl-Histone H1.4-K26 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human tonsil using Acetyl-Histone H1.4-K26 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28437_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human tonsil using Acetyl-Histone H1.4-K26 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat ovary using Acetyl-Histone H1.4-K26 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA28437_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat ovary using Acetyl-Histone H1.4-K26 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
Related Product Information for anti-H1.4-K26 antibody
Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Aug 2015]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
cellular tumor antigen p53 isoform b
NCBI Official Synonym Full Names
transformation related protein 53
NCBI Official Symbol
Trp53
NCBI Official Synonym Symbols
bbl; bfy; bhy; p44; p53; Tp53
NCBI Protein Information
cellular tumor antigen p53; p53 cellular tumor antigen; tumor suppressor p53; tumor supressor p53
UniProt Protein Name
Cellular tumor antigen p53
UniProt Gene Name
Tp53
UniProt Synonym Gene Names
P53; Trp53
UniProt Entry Name
P53_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The H1.4-K26 tp53 (Catalog #AAA28437) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Acetyl-Histone H1.4-K26 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Acetyl-Histone H1.4-K26 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry). IHC 1:50-1:200 IF/ICC: 1:50-1:200. Researchers should empirically determine the suitability of the H1.4-K26 tp53 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PWPLSSFVPS QKTYQGNYGF HLGFLQSGTA KSVMCTYSPP LNKLFCQLAK TCPVQLWVSA TPPAGSRVRA MAIYKKSQHM TEVVRRCPHH ERCSDGDGLA PPQHLIRVEG NLYPEYLEDR QTFRHSVVVP YEPPEAGSEY TTIHYKYMCN SSCMGGMNRR PILTIITLED SSGNLLGRDS FEVRVCACPG RDRRTEEENF RKKEVL. It is sometimes possible for the material contained within the vial of "Acetyl-Histone H1.4-K26, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.