Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199171_WB13.jpg WB (Western Blot) (WB Suggested Anti-ACLY Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysateACLY is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)

Rabbit ACLY Polyclonal Antibody | anti-ACLY antibody

ACLY antibody - middle region

Gene Names
ACLY; ACL; ATPCL; CLATP
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ACLY, Antibody; ACLY antibody - middle region; anti-ACLY antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA
Sequence Length
1101
Applicable Applications for anti-ACLY antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%; Sheep: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACLY
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACLY Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysateACLY is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)

product-image-AAA199171_WB13.jpg WB (Western Blot) (WB Suggested Anti-ACLY Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysateACLY is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)

IHC (Immunohistochemistry)

(Rabbit Anti-ACLY AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199171_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ACLY AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ACLY antibody
This is a rabbit polyclonal antibody against ACLY. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acety
Product Categories/Family for anti-ACLY antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
47
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
121kDa
NCBI Official Full Name
ATP-citrate synthase isoform 1
NCBI Official Synonym Full Names
ATP citrate lyase
NCBI Official Symbol
ACLY
NCBI Official Synonym Symbols
ACL; ATPCL; CLATP
NCBI Protein Information
ATP-citrate synthase
UniProt Protein Name
ATP-citrate synthase
UniProt Gene Name
ACLY
UniProt Synonym Gene Names
ACL
UniProt Entry Name
ACLY_HUMAN

Similar Products

Product Notes

The ACLY acly (Catalog #AAA199171) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACLY antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACLY can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ACLY acly for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRSAYDSTME TMNYAQIRTI AIIAEGIPEA LTRKLIKKAD QKGVTIIGPA. It is sometimes possible for the material contained within the vial of "ACLY, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.