WB (Western Blot)
(WB Suggested Anti-ACOT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Rabbit ACOT2 Polyclonal Antibody | anti-ACOT2 antibody
ACOT2 antibody - middle region
Gene Names
ACOT2; MTE1; PTE2; CTE1A; PTE2A; CTE-IA; ZAP128
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACOT2, Antibody; ACOT2 antibody - middle region; anti-ACOT2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR
Sequence Length
483
Applicable Applications for anti-ACOT2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACOT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ACOT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
WB (Western Blot)
(WB Suggested Anti-ACOT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
WB (Western Blot)
(Host: RabbitTarget Name: ACOT2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: ACOT2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ACOT2 antibody
This is a rabbit polyclonal antibody against ACOT2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA.Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA (Hunt et al., 2005 [PubMed 16103133]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 CR610624.1 1-7 8-1155 BC006335.2 1-1148 1156-1767 L40401.1 468-1079
Target Description: Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA.Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA (Hunt et al., 2005 [PubMed 16103133]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 CR610624.1 1-7 8-1155 BC006335.2 1-1148 1156-1767 L40401.1 468-1079
Product Categories/Family for anti-ACOT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
acyl-coenzyme A thioesterase 2, mitochondrial isoform 1
NCBI Official Synonym Full Names
acyl-CoA thioesterase 2
NCBI Official Symbol
ACOT2
NCBI Official Synonym Symbols
MTE1; PTE2; CTE1A; PTE2A; CTE-IA; ZAP128
NCBI Protein Information
acyl-coenzyme A thioesterase 2, mitochondrial
UniProt Protein Name
Acyl-coenzyme A thioesterase 2, mitochondrial
UniProt Gene Name
ACOT2
UniProt Synonym Gene Names
PTE2; PTE2A; Acyl-CoA thioesterase 2
UniProt Entry Name
ACOT2_HUMAN
Similar Products
Product Notes
The ACOT2 acot2 (Catalog #AAA199098) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACOT2 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACOT2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ACOT2 acot2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPLEGPDQKS FIPVERAEST FLFLVGQDDH NWKSEFYANE ACKRLQAHGR. It is sometimes possible for the material contained within the vial of "ACOT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.