Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201029_WB13.jpg WB (Western Blot) (WB Suggested Anti-ACOX3 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellACOX3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit ACOX3 Polyclonal Antibody | anti-ACOX3 antibody

ACOX3 antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACOX3, Antibody; ACOX3 antibody - C-terminal region; anti-ACOX3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT
Sequence Length
700
Applicable Applications for anti-ACOX3 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ACOX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACOX3 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellACOX3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA201029_WB13.jpg WB (Western Blot) (WB Suggested Anti-ACOX3 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellACOX3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: MouseTarget Name: ACOX3Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA201029_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: ACOX3Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
Related Product Information for anti-ACOX3 antibody
This is a rabbit polyclonal antibody against ACOX3. It was validated on Western Blot

Target Description: Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined.
Product Categories/Family for anti-ACOX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
peroxisomal acyl-coenzyme A oxidase 3 isoform a
NCBI Official Synonym Full Names
acyl-CoA oxidase 3, pristanoyl
NCBI Official Symbol
ACOX3
NCBI Protein Information
peroxisomal acyl-coenzyme A oxidase 3
UniProt Protein Name
Peroxisomal acyl-coenzyme A oxidase 3
UniProt Gene Name
ACOX3
UniProt Synonym Gene Names
BRCOX; PRCOX; BRCACox
UniProt Entry Name
ACOX3_HUMAN

Similar Products

Product Notes

The ACOX3 acox3 (Catalog #AAA201029) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACOX3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACOX3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ACOX3 acox3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SWTTQQGIQE CREACGGHGY LAMNRLGVLR DDNDPNCTYE GDNNILLQQT. It is sometimes possible for the material contained within the vial of "ACOX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.