Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281638_IP10.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of Raji cells using 3ug ACSL1 antibody . Western blot was performed from the immunoprecipitate using ACSL1 antibody at a dilition of 1:1000.)

Rabbit ACSL1 Polyclonal Antibody | anti-ACSL1 antibody

ACSL1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
ACSL1; ACS1; LACS; FACL1; FACL2; LACS1; LACS2
Reactivity
Human, Mouse, Rat
Applications
Immunoprecipitation, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
ACSL1, Antibody; ACSL1 Rabbit pAb; ACS1; FACL1; FACL2; LACS; LACS1; LACS2; ACSL1; anti-ACSL1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
TRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICF
Applicable Applications for anti-ACSL1 antibody
IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 46-275 of human ACSL1 (NP_001273637.1).
Cellular Location
Endoplasmic reticulum membrane, Microsome membrane, Mitochondrion outer membrane, Peroxisome membrane, Single-pass type III membrane protein
Positive Samples
Raji, Mouse kidney, Rat heart
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300ug extracts of Raji cells using 3ug ACSL1 antibody . Western blot was performed from the immunoprecipitate using ACSL1 antibody at a dilition of 1:1000.)

product-image-AAA281638_IP10.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of Raji cells using 3ug ACSL1 antibody . Western blot was performed from the immunoprecipitate using ACSL1 antibody at a dilition of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using ACSL1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281638_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 cells using ACSL1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using ACSL1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281638_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using ACSL1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ACSL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA281638_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ACSL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-ACSL1 antibody
Background: The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ACSL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
698
NCBI Official Full Name
Long-chain-fatty-acid--CoA ligase 1
NCBI Official Synonym Full Names
acyl-CoA synthetase long-chain family member 1
NCBI Official Symbol
ACSL1
NCBI Official Synonym Symbols
ACS1; LACS; FACL1; FACL2; LACS1; LACS2
NCBI Protein Information
long-chain-fatty-acid--CoA ligase 1; LACS 1; LACS 2; acyl-CoA synthetase 1; palmitoyl-CoA ligase 1; palmitoyl-CoA ligase 2; paltimoyl-CoA ligase 1; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 1; long-chain acyl-CoA synthetase 2; long-chain fa
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 1
UniProt Gene Name
ACSL1
UniProt Synonym Gene Names
FACL1; FACL2; LACS; LACS1; LACS2; ACS1; LACS 1; LACS 2
UniProt Entry Name
ACSL1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACSL1 acsl1 (Catalog #AAA281638) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACSL1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACSL1 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the ACSL1 acsl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TRPKPLKPPC DLSMQSVEVA GSGGARRSAL LDSDEPLVYF YDDVTTLYEG FQRGIQVSNN GPCLGSRKPD QPYEWLSYKQ VAELSECIGS ALIQKGFKTA PDQFIGIFAQ NRPEWVIIEQ GCFAYSMVIV PLYDTLGNEA ITYIVNKAEL SLVFVDKPEK AKLLLEGVEN KLIPGLKIIV VMDAYGSELV ERGQRCGVEV TSMKAMEDLG RANRRKPKPP APEDLAVICF. It is sometimes possible for the material contained within the vial of "ACSL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.