Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199708_WB11.jpg WB (Western Blot) (WB Suggested Anti-ACSL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that ACSL3 is expressed in HEK293T)

Rabbit ACSL3 Polyclonal Antibody | anti-ACSL3 antibody

ACSL3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ACSL3; ACS3; FACL3; LACS3; LACS 3; PRO2194
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ACSL3, Antibody; ACSL3 antibody - N-terminal region; anti-ACSL3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
Sequence Length
720
Applicable Applications for anti-ACSL3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ACSL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACSL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that ACSL3 is expressed in HEK293T)

product-image-AAA199708_WB11.jpg WB (Western Blot) (WB Suggested Anti-ACSL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that ACSL3 is expressed in HEK293T)

IHC (Immunohiostchemistry)

(Researcher: Received from anonymousApplication: IHCSpecies+tissue/cell type:THP-1 derived macrophagePrimary antibody dilution: 1:200Secondary antibody: Goat anti-rabbit Alexa Fluor 647Secondary antibody dilution:1:333)

product-image-AAA199708_IHC13.jpg IHC (Immunohiostchemistry) (Researcher: Received from anonymousApplication: IHCSpecies+tissue/cell type:THP-1 derived macrophagePrimary antibody dilution: 1:200Secondary antibody: Goat anti-rabbit Alexa Fluor 647Secondary antibody dilution:1:333)

IHC (Immunohistochemistry)

(Researcher: Received from anonymousApplication: IHCSpecies+tissue/cell type:THP-1 derived macrophage activated with iMtbPrimary antibody dilution: 1:200Secondary antibody: Goat anti-rabbit Alexa Fluor 647Secondary antibody dilution:1:333)

product-image-AAA199708_IHC15.jpg IHC (Immunohistochemistry) (Researcher: Received from anonymousApplication: IHCSpecies+tissue/cell type:THP-1 derived macrophage activated with iMtbPrimary antibody dilution: 1:200Secondary antibody: Goat anti-rabbit Alexa Fluor 647Secondary antibody dilution:1:333)
Related Product Information for anti-ACSL3 antibody
This is a rabbit polyclonal antibody against ACSL3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-ACSL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
long-chain-fatty-acid--CoA ligase 3
NCBI Official Synonym Full Names
acyl-CoA synthetase long chain family member 3
NCBI Official Symbol
ACSL3
NCBI Official Synonym Symbols
ACS3; FACL3; LACS3; LACS 3; PRO2194
NCBI Protein Information
long-chain-fatty-acid--CoA ligase 3
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 3
UniProt Gene Name
ACSL3
UniProt Synonym Gene Names
ACS3; FACL3; LACS3; LACS 3

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACSL3 acsl3 (Catalog #AAA199708) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACSL3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACSL3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ACSL3 acsl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDGLASVLYP GCDTLDKVFT YAKNKFKNKR LLGTREVLNE EDEVQPNGKI. It is sometimes possible for the material contained within the vial of "ACSL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.