Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23467_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTBSample Type: JurkatAntibody Dilution: 1.0ug/mlACTB is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit ACTB Polyclonal Antibody | anti-ACTB antibody

ACTB Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ACTB; BRWS1; PS1TP5BP1
Reactivity
Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ACTB, Antibody; ACTB Antibody - middle region; anti-ACTB antibody
Ordering
Host
Rabbit
Reactivity
Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and may contain up to 2% sucrose.
Sequence
Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
Sequence Length
375
Applicable Applications for anti-ACTB antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ACTB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: ACTBSample Type: JurkatAntibody Dilution: 1.0ug/mlACTB is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA23467_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTBSample Type: JurkatAntibody Dilution: 1.0ug/mlACTB is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: ACTBSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23467_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTBSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ACTBSample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%)

product-image-AAA23467_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTBSample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%)

WB (Western Blot)

(Host: RabbitTarget Name: ACTBSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlACTB is strongly supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA23467_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTBSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlACTB is strongly supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: ACTBSample Type: HelaAntibody Dilution: 1.0ug/mlACTB is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA23467_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTBSample Type: HelaAntibody Dilution: 1.0ug/mlACTB is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

IHC (Immunohistochemistry)

(IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.)

product-image-AAA23467_IHC.jpg IHC (Immunohistochemistry) (IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.)
Related Product Information for anti-ACTB antibody
This is a rabbit polyclonal antibody against ACTB. It was validated on Western Blot

Target Description: This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Product Categories/Family for anti-ACTB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
60
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
actin, cytoplasmic 1
NCBI Official Synonym Full Names
actin beta
NCBI Official Symbol
ACTB
NCBI Official Synonym Symbols
BRWS1; PS1TP5BP1
NCBI Protein Information
actin, cytoplasmic 1
UniProt Protein Name
Actin, cytoplasmic 1
UniProt Gene Name
ACTB
UniProt Entry Name
ACTB_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACTB actb (Catalog #AAA23467) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTB Antibody - middle region reacts with Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACTB can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ACTB actb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TMKIKIIAPP ERKYSVWIGG SILASLSTFQ QMWISKQEYD ESGPSIVHRK. It is sometimes possible for the material contained within the vial of "ACTB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.