Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA45634_IHC11.jpg IHC (Immunohistochemisry) (Anti-ACTH Picoband antibody, AAA45634-3.JPGIHC(P): Rat Kidney Tissue)

Rabbit ACTH Polyclonal Antibody | anti-POMC antibody

Anti-ACTH Antibody

Average rating 0.0
No ratings yet
Gene Names
POMC; LPH; MSH; NPP; POC; ACTH; CLIP
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
ACTH, Antibody; Anti-ACTH Antibody; Pro-opiomelanocortin; proopiomelanocortin; ACTH antibody; Adrenocorticotropic hormone antibody; Adrenocorticotropin antibody; Adrenocorticotropin Hormone antibody; Alpha Melanocyte Stimulating Hormone antibody; alpha-MSH antibody; alphaMSH antibody; Beta Endorphin antibody; Beta Lipotropin antibody; Beta LPH antibody; Beta Melanocyte Stimulating Hormone antibody; Beta-endorphin antibody; beta-MSH antibody; CLIP antibody; Corticotropin antibody; Corticotropin Like Intermediary Peptide antibody; Corticotropin lipotropin antibody; Corticotropin lipotropin precursor antibody; Corticotropin-like intermediary peptide antibody; Gamma LPH antibody; gamma-MSH antibody; Lipotropin Beta antibody; Lipotropin Gamma antibody; Lipotropin, included antibody; LPH antibody; Melanocyte-stimulating hormone, included antibody; Melanotropin Alpha antibody; Melanotropin beta antibody; Melanotropin gamma antibody; Melanotropin, included antibody; Met Enkephalin antibody; Met-enkephalin antibody; MSH antibody; NPP antibody; Opiomelanocortin prepropeptide antibody; POC antibody; POMC antibody; Pomc-1 antibody; Pomc1 antibody; Pomc2 antibody; Pro ACTH endorphin antibody; Pro opiomelanocortin antibody; Pro-opiomelanocortin-alpha antibody; Proopiomelanocortin antibody; Proopiomelanocortin preproprotein antibody; Tetracosactide antibody; anti-POMC antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
267
Applicable Applications for anti-POMC antibody
IHC (Immunohistochemistry)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ACTH (138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Anti-ACTH Picoband antibody, AAA45634-3.JPGIHC(P): Rat Kidney Tissue)

product-image-AAA45634_IHC11.jpg IHC (Immunohistochemisry) (Anti-ACTH Picoband antibody, AAA45634-3.JPGIHC(P): Rat Kidney Tissue)

IHC (Immunohiostchemistry)

(Anti-ACTH Picoband antibody, AAA45634-2.JPGIHC(P): Rat Brain Tissue)

product-image-AAA45634_IHC13.jpg IHC (Immunohiostchemistry) (Anti-ACTH Picoband antibody, AAA45634-2.JPGIHC(P): Rat Brain Tissue)

IHC (Immunohistochemistry)

(Anti-ACTH Picoband antibody, AAA45634-1.JPGIHC(P): Mouse Kidney Tissue)

product-image-AAA45634_IHC15.jpg IHC (Immunohistochemistry) (Anti-ACTH Picoband antibody, AAA45634-1.JPGIHC(P): Mouse Kidney Tissue)
Related Product Information for anti-POMC antibody
Description: Rabbit IgG polyclonal antibody for Pro-opiomelanocortin(POMC) detection. Tested with IHC-P in Human, Mouse, Rat.
Background: Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
29,424 Da
NCBI Official Full Name
Pro-opiomelanocortin
NCBI Official Synonym Full Names
proopiomelanocortin
NCBI Official Symbol
POMC
NCBI Official Synonym Symbols
LPH; MSH; NPP; POC; ACTH; CLIP
NCBI Protein Information
pro-opiomelanocortin; beta-LPH; beta-MSH; alpha-MSH; gamma-LPH; gamma-MSH; beta-endorphin; met-enkephalin; lipotropin beta; lipotropin gamma; melanotropin beta; melanotropin alpha; melanotropin gamma; pro-ACTH-endorphin; adrenocorticotropin; corticotropin-lipotropin; adrenocorticotropic hormone; opiomelanocortin prepropeptide; proopiomelanocortin preproprotein; beta-melanocyte-stimulating hormone; alpha-melanocyte-stimulating hormone; corticotropin-like intermediary peptide
UniProt Protein Name
Pro-opiomelanocortin
UniProt Gene Name
POMC
UniProt Synonym Gene Names
POMC; ACTH; CLIP
UniProt Entry Name
COLI_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The POMC pomc (Catalog #AAA45634) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ACTH Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACTH can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the POMC pomc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACTH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.