Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199018_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTN3Sample Type: Human 293TAntibody Dilution: 1.0 ug/ml)

Rabbit ACTN3 Polyclonal Antibody | anti-ACTN3 antibody

ACTN3 antibody - N-terminal region

Gene Names
ACTN3; ACTN3D
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ACTN3, Antibody; ACTN3 antibody - N-terminal region; anti-ACTN3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY
Sequence Length
901
Applicable Applications for anti-ACTN3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: ACTN3Sample Type: Human 293TAntibody Dilution: 1.0 ug/ml)

product-image-AAA199018_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTN3Sample Type: Human 293TAntibody Dilution: 1.0 ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ACTN3Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199018_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTN3Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ACTN3Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199018_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTN3Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Skeletal muscle)

product-image-AAA199018_IHC15.jpg IHC (Immunohistochemistry) (Skeletal muscle)
Related Product Information for anti-ACTN3 antibody
This is a rabbit polyclonal antibody against ACTN3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Alpha-actinin is an actin-binding protein with multiple roles in different cell types. This protein expression is limited to skeletal muscle. It is localized to the Z-disc and analogous dense bodies, where it helps to anchor the myofibrillar actin filaments.Alpha-actinin is an actin-binding protein with multiple roles in different cell types. This gene expression is limited to skeletal muscle. It is localized to the Z-disc and analogous dense bodies, where it helps to anchor the myofibrillar actin filaments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
89
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103kDa
NCBI Official Full Name
alpha-actinin-3 isoform 1
NCBI Official Synonym Full Names
actinin alpha 3 (gene/pseudogene)
NCBI Official Symbol
ACTN3
NCBI Official Synonym Symbols
ACTN3D
NCBI Protein Information
alpha-actinin-3
UniProt Protein Name
Alpha-actinin-3
UniProt Gene Name
ACTN3
UniProt Entry Name
ACTN3_HUMAN

Similar Products

Product Notes

The ACTN3 actn3 (Catalog #AAA199018) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTN3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACTN3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ACTN3 actn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQNFHTSWKD GLALCALIHR HRPDLIDYAK LRKDDPIGNL NTAFEVAEKY. It is sometimes possible for the material contained within the vial of "ACTN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.