Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198940_WB11.jpg WB (Western Blot) (WB Suggested Anti-ADAMTS4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit ADAMTS4 Polyclonal Antibody | anti-ADAMTS4 antibody

ADAMTS4 antibody - N-terminal region

Gene Names
ADAMTS4; ADMP-1; ADAMTS-2; ADAMTS-4
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ADAMTS4, Antibody; ADAMTS4 antibody - N-terminal region; anti-ADAMTS4 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL
Sequence Length
339
Applicable Applications for anti-ADAMTS4 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Protein Size (# AA)
339 amino acids
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ADAMTS4
Protein Interactions
YTHDC1; ZBTB16; ELAVL1; UBC; MT2A; SRPX2; ADAMTS4; BCAN; SERPINA1; ACAN; HP; FURIN; FN1; SERPINA3;
Blocking Peptide
For anti-ADAMTS4 (MBS3205913) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ADAMTS4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA198940_WB11.jpg WB (Western Blot) (WB Suggested Anti-ADAMTS4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: ADAMTS4Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA198940_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ADAMTS4Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-ADAMTS4 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198940_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ADAMTS4 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-ADAMTS4 antibody
This is a rabbit polyclonal antibody against ADAMTS4. It was validated on Western Blot and immunohistochemistry

Target Description: ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS4 lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.
Product Categories/Family for anti-ADAMTS4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Synonym Full Names
ADAM metallopeptidase with thrombospondin type 1 motif 4
NCBI Official Symbol
ADAMTS4
NCBI Official Synonym Symbols
ADMP-1; ADAMTS-2; ADAMTS-4
NCBI Protein Information
A disintegrin and metalloproteinase with thrombospondin motifs 4

Similar Products

Product Notes

The ADAMTS4 (Catalog #AAA198940) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADAMTS4 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ADAMTS4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ADAMTS4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVQVEGLTVQ YLGQAPELLG GAEPGTYLTG TINGDPESVA SLHWDGGALL. It is sometimes possible for the material contained within the vial of "ADAMTS4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.