Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198747_WB13.jpg WB (Western Blot) (WB Suggested Anti-ADAT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

Rabbit ADAT1 Polyclonal Antibody | anti-ADAT1 antibody

ADAT1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
ADAT1; HADAT1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ADAT1, Antibody; ADAT1 antibody - C-terminal region; anti-ADAT1 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV
Sequence Length
502
Applicable Applications for anti-ADAT1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 79%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ADAT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ADAT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

product-image-AAA198747_WB13.jpg WB (Western Blot) (WB Suggested Anti-ADAT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

IHC (Immunohistochemistry)

(Rabbit Anti-ADAT1 AntibodyParaffin Embedded Tissue: Human StomachCellular Data: Epithelial cells of fundic glandAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198747_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ADAT1 AntibodyParaffin Embedded Tissue: Human StomachCellular Data: Epithelial cells of fundic glandAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-ADAT1 antibody
This is a rabbit polyclonal antibody against ADAT1. It was validated on Western Blot and immunohistochemistry

Target Description: ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.This gene is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, proteins encoded by these genes participate in the pre-mRNA editing of nuclear transcripts. The protein encoded by this gene, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.
Product Categories/Family for anti-ADAT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
tRNA-specific adenosine deaminase 1 isoform a
NCBI Official Synonym Full Names
adenosine deaminase tRNA specific 1
NCBI Official Symbol
ADAT1
NCBI Official Synonym Symbols
HADAT1
NCBI Protein Information
tRNA-specific adenosine deaminase 1
UniProt Protein Name
tRNA-specific adenosine deaminase 1
UniProt Gene Name
ADAT1
UniProt Synonym Gene Names
hADAT1
UniProt Entry Name
ADAT1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ADAT1 adat1 (Catalog #AAA198747) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADAT1 antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADAT1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ADAT1 adat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFRSFQKLLS RIARDKWPHS LRVQKLDTYQ EYKEAASSYQ EAWSTLRKQV. It is sometimes possible for the material contained within the vial of "ADAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.