Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198993_WB13.jpg WB (Western Blot) (WB Suggested Anti-ADH1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)

Rabbit ADH1A Polyclonal Antibody | anti-ADH1A antibody

ADH1A antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ADH1A; ADH1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADH1A, Antibody; ADH1A antibody - N-terminal region; anti-ADH1A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA
Sequence Length
375
Applicable Applications for anti-ADH1A antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Rabbit: 92%; Rat: 92%; Yeast: 85%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ADH1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ADH1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)

product-image-AAA198993_WB13.jpg WB (Western Blot) (WB Suggested Anti-ADH1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)

WB (Western Blot)

(Host: RabbitTarget Name: ADH1ASample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198993_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: ADH1ASample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-ADH1A antibody
This is a rabbit polyclonal antibody against ADH1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ADH1A is class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.This gene encodes class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. This gene is monomorphic and predominant in fetal and infant livers, whereas the genes encoding beta and gamma subunits are polymorphic and strongly expressed in adult livers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
124
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
alcohol dehydrogenase 1A
NCBI Official Synonym Full Names
alcohol dehydrogenase 1A (class I), alpha polypeptide
NCBI Official Symbol
ADH1A
NCBI Official Synonym Symbols
ADH1
NCBI Protein Information
alcohol dehydrogenase 1A
UniProt Protein Name
Alcohol dehydrogenase 1A
UniProt Gene Name
ADH1A
UniProt Synonym Gene Names
ADH1
UniProt Entry Name
ADH1A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ADH1A adh1a (Catalog #AAA198993) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADH1A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ADH1A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ADH1A adh1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NYCLKNDVSN PQGTLQDGTS RFTCRRKPIH HFLGISTFSQ YTVVDENAVA. It is sometimes possible for the material contained within the vial of "ADH1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.