Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-ADPGK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateADPGK is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit ADPGK Polyclonal Antibody | anti-ADPGK antibody

ADPGK antibody - N-terminal region

Gene Names
ADPGK; ADP-GK; 2610017G09Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADPGK; Polyclonal Antibody; ADPGK antibody - N-terminal region; anti-ADPGK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYV
Sequence Length
496
Applicable Applications for anti-ADPGK antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 77%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 83%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ADPGK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ADPGK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateADPGK is supported by BioGPS gene expression data to be expressed in COLO205)

WB (Western Blot) (WB Suggested Anti-ADPGK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateADPGK is supported by BioGPS gene expression data to be expressed in COLO205)

WB (Western Blot)

(Host: RabbitTarget Name: ADPGKSample Type: MCF7Antibody Dilution: 1.0ug/mlADPGK is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot) (Host: RabbitTarget Name: ADPGKSample Type: MCF7Antibody Dilution: 1.0ug/mlADPGK is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: ADPGKSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: ADPGKSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ADPGKSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: ADPGKSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ADPGKSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: ADPGKSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ADPGKSample Type: HelaAntibody Dilution: 1.0ug/mlADPGK is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot) (Host: RabbitTarget Name: ADPGKSample Type: HelaAntibody Dilution: 1.0ug/mlADPGK is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: ADPGKSample Type: 293TAntibody Dilution: 1.0ug/mlADPGK is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot) (Host: RabbitTarget Name: ADPGKSample Type: 293TAntibody Dilution: 1.0ug/mlADPGK is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-ADPGK antibody
This is a rabbit polyclonal antibody against ADPGK. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions. ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).[supplied by OMIM].
Product Categories/Family for anti-ADPGK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
ADP-dependent glucokinase isoform 1
NCBI Official Synonym Full Names
ADP dependent glucokinase
NCBI Official Symbol
ADPGK
NCBI Official Synonym Symbols
ADP-GK; 2610017G09Rik
NCBI Protein Information
ADP-dependent glucokinase
UniProt Protein Name
ADP-dependent glucokinase
UniProt Gene Name
ADPGK
UniProt Synonym Gene Names
ADP-GK; ADPGK
UniProt Entry Name
ADPGK_HUMAN

Similar Products

Product Notes

The ADPGK adpgk (Catalog #AAA23436) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADPGK antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADPGK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADPGK adpgk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SILHSRNDLE EAFIHFMGKG AAAERFFSDK ETFHDIAQVA SEFPGAQHYV. It is sometimes possible for the material contained within the vial of "ADPGK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.