Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201646_WB13.jpg WB (Western Blot) (WB Suggested Anti-ADRB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)

Rabbit anti-Human ADRB2 Polyclonal Antibody | anti-ADRB2 antibody

ADRB2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ADRB2; BAR; B2AR; ADRBR; ADRB2R; BETA2AR
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADRB2, Antibody; ADRB2 antibody - middle region; anti-ADRB2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN
Sequence Length
413
Applicable Applications for anti-ADRB2 antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ADRB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ADRB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)

product-image-AAA201646_WB13.jpg WB (Western Blot) (WB Suggested Anti-ADRB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: ADRB2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA201646_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: ADRB2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ADRB2 antibody
This is a rabbit polyclonal antibody against ADRB2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This protein is beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene is intronless. Different polymorphic forms, point mutations, and/or downregulation of this gene are associated with nocturnal asthma, obesity and type 2 diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
154
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
beta-2 adrenergic receptor
NCBI Official Synonym Full Names
adrenoceptor beta 2
NCBI Official Symbol
ADRB2
NCBI Official Synonym Symbols
BAR; B2AR; ADRBR; ADRB2R; BETA2AR
NCBI Protein Information
beta-2 adrenergic receptor
UniProt Protein Name
Beta-2 adrenergic receptor
UniProt Gene Name
ADRB2
UniProt Synonym Gene Names
ADRB2R; B2AR; Beta-2 adrenoceptor
UniProt Entry Name
ADRB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ADRB2 adrb2 (Catalog #AAA201646) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADRB2 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADRB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ADRB2 adrb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGEQSGYHVE QEKENKLLCE DLPGTEDFVG HQGTVPSDNI DSQGRNCSTN. It is sometimes possible for the material contained within the vial of "ADRB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.