Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281083_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using AGFG1 antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Mouse AGFG1 Polyclonal Antibody | anti-AGFG1 antibody

AGFG1 Polyclonal Antibody

Gene Names
AGFG1; HRB; RAB; RIP
Reactivity
Human, Mouse
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
AGFG1, Antibody; AGFG1 Polyclonal Antibody; HRB; RAB; RIP; anti-AGFG1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNF
Sequence Length
584
Applicable Applications for anti-AGFG1 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human AGFG1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasmic vesicle, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using AGFG1 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA281083_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using AGFG1 antibody. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using AGFG1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.)

product-image-AAA281083_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using AGFG1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.)
Related Product Information for anti-AGFG1 antibody
The protein encoded by this gene is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. The encoded protein binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-AGFG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 54kDa; 58kDa; 60kDa
Observed: 58kDa
NCBI Official Full Name
arf-GAP domain and FG repeat-containing protein 1 isoform 1
NCBI Official Synonym Full Names
ArfGAP with FG repeats 1
NCBI Official Symbol
AGFG1
NCBI Official Synonym Symbols
HRB; RAB; RIP
NCBI Protein Information
arf-GAP domain and FG repeat-containing protein 1
UniProt Protein Name
Arf-GAP domain and FG repeat-containing protein 1
UniProt Gene Name
AGFG1
UniProt Synonym Gene Names
HRB; RAB; RIP

Similar Products

Product Notes

The AGFG1 agfg1 (Catalog #AAA281083) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGFG1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's AGFG1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the AGFG1 agfg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAASAKRKQE EKHLKMLRDM TGLPHNRKCF DCDQRGPTYV NMTVGSFVCT SCSGSLRGLN PPHRVKSISM TTFTQQEIEF LQKHGNEVCK QIWLGLFDDR SSAIPDFRDP QKVKEFLQEK YEKKRWYVPP EQAKVVASVH ASISGSSASS TSSTPEVKPL KSLLGDSAPT LHLNKGTPSQ SPVVGRSQGQ QQEKKQFDLL SDLGSDIFAA PAPQSTATAN FANFAHFNSH AAQNSANADF ANFDAFGQSS GSSNF. It is sometimes possible for the material contained within the vial of "AGFG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.