Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199287_WB11.jpg WB (Western Blot) (WB Suggested Anti-AGT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Rabbit AGT Polyclonal Antibody | anti-AGT antibody

AGT antibody - N-terminal region

Gene Names
AGT; ANHU; hFLT1; SERPINA8
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AGT, Antibody; AGT antibody - N-terminal region; anti-AGT antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
Sequence Length
485
Applicable Applications for anti-AGT antibody
WB (Western Blot)
Homology
Dog: 92%; Horse: 85%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 93%; Sheep: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AGT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-AGT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

product-image-AAA199287_WB11.jpg WB (Western Blot) (WB Suggested Anti-AGT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

WB (Western Blot)

(Host: RabbitTarget Name: EGFL8Sample Type: HepG2Antibody Dilution: 1.0ug/mlAGT is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA199287_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: EGFL8Sample Type: HepG2Antibody Dilution: 1.0ug/mlAGT is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: AGTSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199287_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: AGTSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-AGT antibody
This is a rabbit polyclonal antibody against AGT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AGT, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease.The protein encoded by this gene, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
183
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
angiotensinogen preproprotein
NCBI Official Synonym Full Names
angiotensinogen
NCBI Official Symbol
AGT
NCBI Official Synonym Symbols
ANHU; hFLT1; SERPINA8
NCBI Protein Information
angiotensinogen
UniProt Protein Name
Angiotensinogen
UniProt Gene Name
AGT
UniProt Synonym Gene Names
SERPINA8; Ang I; Ang II; Ang III; Ang IV
UniProt Entry Name
ANGT_HUMAN

Similar Products

Product Notes

The AGT agt (Catalog #AAA199287) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGT antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's AGT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AGT agt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IHPFHLVIHN ESTCEQLAKA NAGKPKDPTF IPAPIQAKTS PVDEKALQDQ. It is sometimes possible for the material contained within the vial of "AGT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.