Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46320_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of HEPG2 cells using anti-Fetuin A antibody (AAA46320).Overlay histogram showing HEPG2 cells stained with AAA46320 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Fetuin A Antibody (AAA46320,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

anti-Human, Rat AHSG Polyclonal Antibody | anti-AHSG antibody

Anti-AHSG Antibody

Average rating 0.0
No ratings yet
Gene Names
AHSG; AHS; A2HS; HSGA; FETUA
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
AHSG, Antibody; Anti-AHSG Antibody; Alpha-2-HS-glycoprotein; 59 kDa bone sialic acid-containing protein; A2HS; Aa2-066; AHS; Ahsg alpha-2-HS-glycoprotein; Ahsg; Alpha 2 HS Glycoprotein; Alpha 2 Z globulin; Alpha-2-HS-glycoprotein chain B; Alpha-2-Z-globulin; Asialofetuin; Ba alpha 2 glycoprotein; Ba-alpha-2-glycoprotein; BSP; Countertrypin; Fetua; FETUA_HUMAN; Fetuin, mouse, homolog of; Fetuin A; Fetuin-A; Glycoprotein PP63; HSGA; pp63; alpha-2-HS-glycoprotein; anti-AHSG antibody
Ordering
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
367
Applicable Applications for anti-AHSG antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human AHSG (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of HEPG2 cells using anti-Fetuin A antibody (AAA46320).Overlay histogram showing HEPG2 cells stained with AAA46320 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Fetuin A Antibody (AAA46320,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46320_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of HEPG2 cells using anti-Fetuin A antibody (AAA46320).Overlay histogram showing HEPG2 cells stained with AAA46320 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Fetuin A Antibody (AAA46320,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of AHSG using anti-AHSG antibody (AAA46320).AHSG was detected in paraffin-embedded section of Human Liver Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-AHSG Antibody (AAA46320) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46320_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of AHSG using anti-AHSG antibody (AAA46320).AHSG was detected in paraffin-embedded section of Human Liver Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-AHSG Antibody (AAA46320) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of AHSG using anti-AHSG antibody (AAA46320).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Brain Tissue Lysate,Lane 2: RH35 Whole Cell Lysate,Lane 3: MCF-7 Whole Cell Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AHSG antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AHSG at approximately 58KD. The expected band size for AHSG is at 39KD.)

product-image-AAA46320_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of AHSG using anti-AHSG antibody (AAA46320).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Brain Tissue Lysate,Lane 2: RH35 Whole Cell Lysate,Lane 3: MCF-7 Whole Cell Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AHSG antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AHSG at approximately 58KD. The expected band size for AHSG is at 39KD.)
Related Product Information for anti-AHSG antibody
Description: Rabbit IgG polyclonal antibody for Alpha-2-HS-glycoprotein(AHSG) detection. Tested with WB, IHC-P, ELISA in Human;Rat.

Background: Alpha-2-HS-glycoprotein (AHSG), also known as fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.
References
1. "Entrez Gene: AHSG alpha-2-HS-glycoprotein". 2. Osawa M, Umetsu K, Sato M, Ohki T, Yukawa N, Suzuki T, Takeichi S (September 1997). "Structure of the gene encoding human alpha 2-HS glycoprotein (AHSG)". Gene 196 (1-2): 121-5. 3. Rizzu P, Baldini A (1995). "Three members of the human cystatin gene superfamily, AHSG, HRG, and KNG, map within one megabase of genomic DNA at 3q27". Cytogenet. Cell Genet. 70 (1-2): 26-8.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
197
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,325 Da
NCBI Official Full Name
alpha-2-HS-glycoprotein preproprotein
NCBI Official Synonym Full Names
alpha-2-HS-glycoprotein
NCBI Official Symbol
AHSG
NCBI Official Synonym Symbols
AHS; A2HS; HSGA; FETUA
NCBI Protein Information
alpha-2-HS-glycoprotein
UniProt Protein Name
Alpha-2-HS-glycoprotein
UniProt Gene Name
AHSG
UniProt Synonym Gene Names
FETUA
UniProt Entry Name
FETUA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The AHSG ahsg (Catalog #AAA46320) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-AHSG Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AHSG can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the AHSG ahsg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AHSG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.