Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282397_WB13.jpg WB (Western Blot) (Western blot analysis of Rat kidney, using Ajuba Rabbit pAb antibody (AAA282397) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

Rabbit anti-Human, Rat Ajuba Polyclonal Antibody | anti-Ajuba antibody

[KO Validated] Ajuba Rabbit pAb

Gene Names
AJUBA; JUB
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
Ajuba, Antibody; [KO Validated] Ajuba Rabbit pAb; JUB; anti-Ajuba antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
PSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGT
Applicable Applications for anti-Ajuba antibody
WB (Western Blot)
Positive Samples
HepG2, Rat kidney
Cellular Location
adherens junction, cell-cell junction, cytosol, Golgi apparatus, microtubule organizing center, nucleoplasm, nucleus, P-body, plasma membrane
Research Area
Cell Biology Developmental Biology, Cell Adhesion, Cytoskeleton, Stem Cells
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human Ajuba (NP_116265.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

WB (Western Blot)

(Western blot analysis of Rat kidney, using Ajuba Rabbit pAb antibody (AAA282397) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

product-image-AAA282397_WB13.jpg WB (Western Blot) (Western blot analysis of Rat kidney, using Ajuba Rabbit pAb antibody (AAA282397) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of HepG2, using Ajuba Rabbit pAb antibody (AAA282397) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.)

product-image-AAA282397_WB15.jpg WB (Western Blot) (Western blot analysis of HepG2, using Ajuba Rabbit pAb antibody (AAA282397) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.)
Related Product Information for anti-Ajuba antibody
Enables alpha-catenin binding activity and transcription corepressor activity. Involved in several processes, including negative regulation of hippo signaling; positive regulation of gene silencing by miRNA; and regulation of cellular response to hypoxia. Acts upstream of or within gene silencing by miRNA and positive regulation of protein-containing complex assembly. Located in several cellular components, including Golgi apparatus; P-body; and nucleoplasm.
Product Categories/Family for anti-Ajuba antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
13,795 Da
NCBI Official Full Name
ajuba
NCBI Official Synonym Full Names
ajuba LIM protein
NCBI Official Symbol
AJUBA
NCBI Official Synonym Symbols
JUB
NCBI Protein Information
LIM domain-containing protein ajuba
UniProt Protein Name
LIM domain-containing protein ajuba
UniProt Gene Name
AJUBA
UniProt Synonym Gene Names
JUB

Similar Products

Product Notes

The Ajuba ajuba (Catalog #AAA282397) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Ajuba Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ajuba can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the Ajuba ajuba for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PSAYPELHAA LDRLYAQRPA GFGCQESRHS YPPALGSPGA LAGAGVGAAG PLERRGAQPG RHSVTGYGDC AVGARYQDEL TALLRLTVGT. It is sometimes possible for the material contained within the vial of "Ajuba, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.