Rabbit anti-Mouse AKR1B8 Polyclonal Antibody | anti-AKR1B8 antibody
AKR1B8 Antibody - middle region
Gene Names
Akr1b8; FR-1; Fgrp; Fgfrp
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
AKR1B8, Antibody; AKR1B8 Antibody - middle region; anti-AKR1B8 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: TNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLED
Sequence Length
316
Applicable Applications for anti-AKR1B8 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse AKR1B8
Protein Size (# AA)
316 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-AKR1B8 antibody
The function of this protein remains unknown.
Product Categories/Family for anti-AKR1B8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
aldose reductase-related protein 2
NCBI Official Synonym Full Names
aldo-keto reductase family 1, member B8
NCBI Official Symbol
Akr1b8
NCBI Official Synonym Symbols
FR-1; Fgrp; Fgfrp
NCBI Protein Information
aldose reductase-related protein 2
UniProt Protein Name
Aldose reductase-related protein 2
UniProt Gene Name
Akr1b8
UniProt Synonym Gene Names
Fgfrp; AR
UniProt Entry Name
ALD2_MOUSE
Similar Products
Product Notes
The AKR1B8 akr1b8 (Catalog #AAA201627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKR1B8 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1B8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AKR1B8 akr1b8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TNQVECHPYL TQEKLIQYCH SKGISVTAYS PLGSPDRPSA KPEDPSLLED. It is sometimes possible for the material contained within the vial of "AKR1B8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
