Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46572_IHC11.jpg IHC (Immunohistochemisry) (Anti- ALDH2 Picoband antibody, AAA46572, IHC(P)IHC(P): Human Kidney Cancer Tissue)

ALDH2 Polyclonal Antibody | anti-ALDH2 antibody

Anti-ALDH2 Antibody

Average rating 0.0
No ratings yet
Gene Names
ALDH2; ALDM; ALDHI; ALDH-E2
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
ALDH2, Antibody; Anti-ALDH2 Antibody; Aldehyde dehydrogenase; Acetaldehyde dehydrogenase 2; Aldehyde dehydrogenase 2 family (mitochondrial); Aldehyde dehydrogenase 2 family; Aldehyde dehydrogenase mitochondrial; Aldehyde dehydrogenase, mitochondrial; ALDH 2; ALDH class 2; ALDH E2; ALDH-E2; Aldh2; ALDH2_HUMAN; ALDHI; ALDM; Liver mitochondrial ALDH; MGC1806; Mitochondrial aldehyde dehydrogenase 2; MS767; Nucleus encoded mitochondrial aldehyde dehydrogenase 2 antibody; aldehyde dehydrogenase 2 family (mitochondrial); anti-ALDH2 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
517
Applicable Applications for anti-ALDH2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Anti- ALDH2 Picoband antibody, AAA46572, IHC(P)IHC(P): Human Kidney Cancer Tissue)

product-image-AAA46572_IHC11.jpg IHC (Immunohistochemisry) (Anti- ALDH2 Picoband antibody, AAA46572, IHC(P)IHC(P): Human Kidney Cancer Tissue)

IHC (Immunohiostchemistry)

(Anti- ALDH2 Picoband antibody, AAA46572, IHC(P)IHC(P): Rat Liver Tissue)

product-image-AAA46572_IHC13.jpg IHC (Immunohiostchemistry) (Anti- ALDH2 Picoband antibody, AAA46572, IHC(P)IHC(P): Rat Liver Tissue)

WB (Western Blot)

(Anti- ALDH2 Picoband antibody, AAA46572, Western blottingAll lanes: Anti ALDH2 (AAA46572) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugPredicted bind size: 56KDObserved bind size: 56KD)

product-image-AAA46572_WB15.jpg WB (Western Blot) (Anti- ALDH2 Picoband antibody, AAA46572, Western blottingAll lanes: Anti ALDH2 (AAA46572) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugPredicted bind size: 56KDObserved bind size: 56KD)
Related Product Information for anti-ALDH2 antibody
Description: Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial(ALDH2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.
References
1. Chen, C.-H., Budas, G. R., Churchill, E. N., Disatnik, M.-H., Hurley, T. D., Mochly-Rosen, D. Activation of aldehyde dehydrogenase-2 reduces ischemic damage to the heart. Science 321: 1493-1495, 2008. 2. Goedde, H. W., Agarwal, D. P., Fritze, G., Meier-Tackmann, D., Singh, S., Beckmann, G., Bhatia, K., Chen, L. Z., Fang, B., Lisker, R., Paik, Y. K., Rothhammer, F., Saha, N., Segal, B., Srivastava, L. M., Czeizel, A. Distribution of ADH-2 and ALDH2 genotypes in different populations. Hum. Genet. 88: 344-346, 1992. 3. Hsu, L. C., Yoshida, A., Mohandas, T. Chromosomal assignment of the genes for human aldehyde dehydrogenase 1 (ALDH1) and aldehyde dehydrogenase 2 (ALDH2). (Abstract) Cytogenet. Cell Genet. 40: 656-657, 1985.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
217
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,989 Da
NCBI Official Full Name
aldehyde dehydrogenase, mitochondrial isoform 1
NCBI Official Synonym Full Names
aldehyde dehydrogenase 2 family (mitochondrial)
NCBI Official Symbol
ALDH2
NCBI Official Synonym Symbols
ALDM; ALDHI; ALDH-E2
NCBI Protein Information
aldehyde dehydrogenase, mitochondrial
UniProt Protein Name
Aldehyde dehydrogenase, mitochondrial
UniProt Gene Name
ALDH2
UniProt Synonym Gene Names
ALDM
UniProt Entry Name
ALDH2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ALDH2 aldh2 (Catalog #AAA46572) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ALDH2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ALDH2 aldh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALDH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.