Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281833_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using ALG5 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit ALG5 Polyclonal Antibody | anti-ALG5 antibody

ALG5 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
ALG5; bA421P11.2
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
ALG5, Antibody; ALG5 Rabbit pAb; ALG5; bA421P11.2; anti-ALG5 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQM
Applicable Applications for anti-ALG5 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 34-190 of human ALG5 (NP_037470.1).
Positive Samples
U-87MG, HepG2, 293T
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using ALG5 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281833_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using ALG5 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human colon carcinoma using ALG5 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281833_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human colon carcinoma using ALG5 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded Rat ovary using ALG5 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281833_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Rat ovary using ALG5 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Mouse pancreas using ALG5 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281833_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Mouse pancreas using ALG5 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ALG5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281833_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ALG5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-ALG5 antibody
Background: This gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition, and therefore, effectual transfer of the oligomannose core to the nascent glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008]
Product Categories/Family for anti-ALG5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted MW: 37kDa
NCBI Official Full Name
dolichyl-phosphate beta-glucosyltransferase isoform 2
NCBI Official Synonym Full Names
ALG5, dolichyl-phosphate beta-glucosyltransferase
NCBI Official Symbol
ALG5
NCBI Official Synonym Symbols
bA421P11.2
NCBI Protein Information
dolichyl-phosphate beta-glucosyltransferase
UniProt Protein Name
Dolichyl-phosphate beta-glucosyltransferase
UniProt Gene Name
ALG5
UniProt Synonym Gene Names
DolP-glucosyltransferase

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ALG5 alg5 (Catalog #AAA281833) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALG5 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALG5 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ALG5 alg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPALHRHEEE KFFLNAKGQK ETLPSIWDSP TKQLSVVVPS YNEEKRLPVM MDEALSYLEK RQKRDPAFTY EVIVVDDGSK DQTSKVAFKY CQKYGSDKVR VITLVKNRGK GGAIRMGIFS SRGEKILMAD ADGATKFPDV EKLEKGLNDL QPWPNQM. It is sometimes possible for the material contained within the vial of "ALG5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.