Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA142220_IHC13.jpg IHC (Immunohiostchemistry) (DAB staining on fromalin fixed paraffin- embedded Kidney tissue))

Rabbit anti-Mouse Angiotensin I Converting Enzyme Polyclonal Antibody | anti-ACE antibody

Polyclonal Antibody to Angiotensin I Converting Enzyme (ACE)

Gene Names
Ace; CD143; AW208573
Reactivity
Mouse
Applications
ELISA, Immunohistochemistry, Immunocytochemistry, Western Blot
Purity
Affinity Chromatography
Synonyms
Angiotensin I Converting Enzyme, Antibody; Polyclonal Antibody to Angiotensin I Converting Enzyme (ACE); anti-ACE antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against ACE. It has beenselected for its ability to recognize ACE in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Liquid
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and S-tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-FFTSLGL SPMPPEFWAE SMLEKPTDGR EVVCHASAWD FYNRKDFRIK QCTRVTMEQL
Applicable Applications for anti-ACE antibody
ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry), WB (Western Blot)
Fragment
ACE (Phe334~Leu409)
Organism Species
Mus musculus (Mouse)
Cross Reactivity
Mouse
Conjugate
No Conjugate
Immunogen
Recombinant ACE (Phe334~Leu409) expressed in E Coli.
Conjugated Antibody
The APC conjugated antibody version of this item is also available as
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

IHC (Immunohiostchemistry)

(DAB staining on fromalin fixed paraffin- embedded Kidney tissue))

product-image-AAA142220_IHC13.jpg IHC (Immunohiostchemistry) (DAB staining on fromalin fixed paraffin- embedded Kidney tissue))

WB (Western Blot)

(Western Blot: Sample: Recombinant protein.)

product-image-AAA142220_WB15.jpg WB (Western Blot) (Western Blot: Sample: Recombinant protein.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,047 Da
NCBI Official Full Name
angiotensin-converting enzyme isoform 2
NCBI Official Synonym Full Names
angiotensin I converting enzyme (peptidyl-dipeptidase A) 1
NCBI Official Symbol
Ace
NCBI Official Synonym Symbols
CD143; AW208573
NCBI Protein Information
angiotensin-converting enzyme
UniProt Protein Name
Angiotensin-converting enzyme
UniProt Gene Name
Ace
UniProt Synonym Gene Names
Dcp1; ACE

Similar Products

Product Notes

The ACE ace (Catalog #AAA142220) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Angiotensin I Converting Enzyme (ACE) reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Angiotensin I Converting Enzyme can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ACE ace for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and S-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-FFTSLGL SPMPPEFWAE SMLEKPTDGR EVVCHASAWD FYNRKDFRIK QCTRVTMEQL. It is sometimes possible for the material contained within the vial of "Angiotensin I Converting Enzyme, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.