Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46753_IHC8.jpg IHC (Immunohistochemistry) (ANGPTL2 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit ANGPTL2 Polyclonal Antibody | anti-ANGPTL2 antibody

Anti-ANGPTL2 Antibody

Gene Names
ANGPTL2; ARP2; HARP
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
ANGPTL2, Antibody; Anti-ANGPTL2 Antibody; AI593246; Angptl2; Arp2; HARP; MGC8889; UNQ170/PRO196; Q9UKU9; Angiopoietin-related protein 2; angiopoietin like 2; anti-ANGPTL2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
493
Applicable Applications for anti-ANGPTL2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275-312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD), different from the related mouse sequence by one amino acid.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(ANGPTL2 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46753_IHC8.jpg IHC (Immunohistochemistry) (ANGPTL2 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemistry)

(ANGPTL2 was detected in paraffin-embedded sections of rat cardiac muscle tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46753_IHC10.jpg IHC (Immunohistochemistry) (ANGPTL2 was detected in paraffin-embedded sections of rat cardiac muscle tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(ANGPTL2 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46753_IHC11.jpg IHC (Immunohistochemisry) (ANGPTL2 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(ANGPTL2 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46753_IHC13.jpg IHC (Immunohiostchemistry) (ANGPTL2 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of ANGPTL2 expression in rat stomach extract (lane 1) and mouse ovary extract (lane 2). ANGPTL2 at 57KD was detected using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46753_WB15.jpg WB (Western Blot) (Western blot analysis of ANGPTL2 expression in rat stomach extract (lane 1) and mouse ovary extract (lane 2). ANGPTL2 at 57KD was detected using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-ANGPTL2 antibody
Rabbit IgG polyclonal antibody for Angiopoietin-related protein 2(ANGPTL2) detection.
Background: Angiopoietin-related protein 2, also known as angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.
References
1. "Entrez Gene: ANGPTL2 angiopoietin-like 2".
2. Kim I, Moon SO, Koh KN, Kim H, Uhm CS, Kwak HJ, Kim NG, Koh GY (Oct 1999). "Molecular cloning, expression, and characterization of angiopoietin-related protein. angiopoietin-related protein induces endothelial cell sprouting". J Biol Chem. 274 (37): 26523-8.
3. Sun H, Zheng JM, Chen S, et al. (2007). "Enhanced expression of ANGPTL2 in the microvascular lesions of diabetic glomerulopathy". Nephron Exp. Nephrol.105 (4): e117-23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,717 Da
NCBI Official Full Name
angiopoietin-related protein 2
NCBI Official Synonym Full Names
angiopoietin like 2
NCBI Official Symbol
ANGPTL2
NCBI Official Synonym Symbols
ARP2; HARP
NCBI Protein Information
angiopoietin-related protein 2
UniProt Protein Name
Angiopoietin-related protein 2
UniProt Gene Name
ANGPTL2
UniProt Synonym Gene Names
ARP2

Similar Products

Product Notes

The ANGPTL2 angptl2 (Catalog #AAA46753) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ANGPTL2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ANGPTL2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ANGPTL2 angptl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANGPTL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.