WB (Western Blot)
(WB Suggested Anti-ANKS1B AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Rabbit ANKS1B Polyclonal Antibody | anti-ANKS1B antibody
ANKS1B Antibody - C-terminal region
Gene Names
ANKS1B; EB1; AIDA; EB-1; ANKS2; AIDA-1; cajalin-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ANKS1B, Antibody; ANKS1B Antibody - C-terminal region; anti-ANKS1B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNI
Sequence Length
357
Applicable Applications for anti-ANKS1B antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKS1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ANKS1B AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
WB (Western Blot)
(WB Suggested Anti-ANKS1B AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
WB (Western Blot)
(Host: RabbitTarget Name: ANKS1BSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: ANKS1BSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ANKS1B antibody
This is a rabbit polyclonal antibody against ANKS1B. It was validated on Western Blot
Target Description: This gene encodes a multi-domain protein that is predominantly expressed in brain and testis. This protein interacts with amyloid beta protein precursor (AbetaPP) and may have a role in normal brain development, and in the pathogenesis of Alzheimer's disease. Expression of this gene has been shown to be elevated in patients with pre-B cell acute lymphocytic leukemia associated with t(1;19) translocation. Alternatively spliced transcript variants encoding different isoforms (some with different subcellular localization, PMID:15004329) have been described for this gene.
Target Description: This gene encodes a multi-domain protein that is predominantly expressed in brain and testis. This protein interacts with amyloid beta protein precursor (AbetaPP) and may have a role in normal brain development, and in the pathogenesis of Alzheimer's disease. Expression of this gene has been shown to be elevated in patients with pre-B cell acute lymphocytic leukemia associated with t(1;19) translocation. Alternatively spliced transcript variants encoding different isoforms (some with different subcellular localization, PMID:15004329) have been described for this gene.
Product Categories/Family for anti-ANKS1B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40kDa
NCBI Official Full Name
ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform e
NCBI Official Synonym Full Names
ankyrin repeat and sterile alpha motif domain containing 1B
NCBI Official Symbol
ANKS1B
NCBI Official Synonym Symbols
EB1; AIDA; EB-1; ANKS2; AIDA-1; cajalin-2
NCBI Protein Information
ankyrin repeat and sterile alpha motif domain-containing protein 1B
Similar Products
Product Notes
The ANKS1B (Catalog #AAA201362) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANKS1B Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ANKS1B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ANKS1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ACAKMRANCQ KSTEQMKKVP TIILSVSYKG VKFIDATNKN IIAEHEIRNI. It is sometimes possible for the material contained within the vial of "ANKS1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.