Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281275_IP10.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of HeLa cells using 1ug APEX1 antibody. Western blot was performed from the immunoprecipitate using APEX1 antibody at a dilition of 1:1000.)

Rabbit anti-Human APEX1 Polyclonal Antibody | anti-APEX1 antibody

APEX1 Polyclonal Antibody

Gene Names
APEX1; APE; APX; APE1; APEN; APEX; HAP1; REF1
Reactivity
Human
Applications
Immunoprecipitation, Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
APEX1, Antibody; APEX1 Polyclonal Antibody; APE; APE1; APEN; APEX; APX; HAP1; REF1; anti-APEX1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRH
Sequence Length
318
Applicable Applications for anti-APEX1 antibody
IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human APEX1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus, Nucleus speckle, nucleolus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 200ug extracts of HeLa cells using 1ug APEX1 antibody. Western blot was performed from the immunoprecipitate using APEX1 antibody at a dilition of 1:1000.)

product-image-AAA281275_IP10.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of HeLa cells using 1ug APEX1 antibody. Western blot was performed from the immunoprecipitate using APEX1 antibody at a dilition of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A549 cells using APEX1 antibody.)

product-image-AAA281275_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using APEX1 antibody.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using APEX1 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA281275_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using APEX1 antibody. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using APEX1 antibody.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA281275_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using APEX1 antibody.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-APEX1 antibody
Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.
Product Categories/Family for anti-APEX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
328
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 35kDa
Observed: 39kDa
NCBI Official Full Name
DNA-(apurinic or apyrimidinic site) lyase
NCBI Official Synonym Full Names
apurinic/apyrimidinic endodeoxyribonuclease 1
NCBI Official Symbol
APEX1
NCBI Official Synonym Symbols
APE; APX; APE1; APEN; APEX; HAP1; REF1
NCBI Protein Information
DNA-(apurinic or apyrimidinic site) lyase
UniProt Protein Name
DNA-(apurinic or apyrimidinic site) lyase
UniProt Gene Name
APEX1
UniProt Synonym Gene Names
APE; APE1; APEX; APX; HAP1; REF1; APEN; AP endonuclease 1; APE-1

Similar Products

Product Notes

The APEX1 apex1 (Catalog #AAA281275) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APEX1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APEX1 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the APEX1 apex1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPKRGKKGAV AEDGDELRTE PEAKKSKTAA KKNDKEAAGE GPALYEDPPD QKTSPSGKPA TLKICSWNVD GLRAWIKKKG LDWVKEEAPD ILCLQETKCS ENKLPAELQE LPGLSHQYWS APSDKEGYSG VGLLSRQCPL KVSYGIGDEE HDQEGRVIVA EFDSFVLVTA YVPNAGRGLV RLEYRQRWDE AFRKFLKGLA SRKPLVLCGD LNVAHEEIDL RNPKGNKKNA GFTPQERQGF GELLQAVPLA DSFRH. It is sometimes possible for the material contained within the vial of "APEX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.