Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-APOA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)

Rabbit APOA2 Polyclonal Antibody | anti-APOA2 antibody

APOA2 antibody - N-terminal region

Gene Names
APOA2; apoAII; Apo-AII; ApoA-II
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APOA2; Polyclonal Antibody; APOA2 antibody - N-terminal region; anti-APOA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
Sequence Length
100
Applicable Applications for anti-APOA2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APOA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-APOA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)

WB (Western Blot) (WB Suggested Anti-APOA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: APOA2Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlAPOA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot) (Host: RabbitTarget Name: APOA2Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlAPOA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot)

(Host: RabbitTarget Name: APOA2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: APOA2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: APOA2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: APOA2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: APOA2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: APOA2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: APOA2Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: APOA2Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-APOA2 antibody
This is a rabbit polyclonal antibody against APOA2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.
Product Categories/Family for anti-APOA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
336
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9kDa
NCBI Official Full Name
apolipoprotein A-II preproprotein
NCBI Official Synonym Full Names
apolipoprotein A2
NCBI Official Symbol
APOA2
NCBI Official Synonym Symbols
apoAII; Apo-AII; ApoA-II
NCBI Protein Information
apolipoprotein A-II
UniProt Protein Name
Apolipoprotein A-II
UniProt Gene Name
APOA2
UniProt Synonym Gene Names
Apo-AII; ApoA-II
UniProt Entry Name
APOA2_HUMAN

Similar Products

Product Notes

The APOA2 apoa2 (Catalog #AAA23556) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOA2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's APOA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOA2 apoa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKLLAATVLL LTICSLEGAL VRRQAKEPCV ESLVSQYFQT VTDYGKDLME. It is sometimes possible for the material contained within the vial of "APOA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.