Rabbit APOBEC3 Polyclonal Antibody | anti-APOBEC3 antibody
APOBEC3 Antibody - middle region
Gene Names
Apobec3; Arp3; Rfv3; Cem15; Apobec; Gm20117; BC003314
Reactivity
Tested: MousePredicted: Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
APOBEC3, Antibody; APOBEC3 Antibody - middle region; anti-APOBEC3 antibody
Host
Rabbit
Reactivity
Tested: Mouse
Predicted: Mouse
Predicted: Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range : 100 ul at 0.5-1mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: AQVAAMDLYEFKKCWKKFVDNGGRRFRPWKRLLTNFRYQDSKLQEILRPC
Sequence Length
429 amino acids
Applicable Applications for anti-APOBEC3 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse APOBEC3
Blocking Peptide
For anti-APOBEC3 (MBS3223633) antibody is Catalog #
Tissue Tool
Find tissues and cell lines supported by DNA array analysis to express APOBEC3.
RNA Seq
Find tissues and cell lines supported by RNA-seq analysis to express APOBEC3.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-APOBEC3 antibody
DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single-or double-stranded RNA. Exhibits antiviral activity against HIV-1, simian immunodeficiency viruses (SIVs), mouse mammary tumor virus (MMTV) and friend murine leukemia virus (FrMLV) and may inhibit the mobility of LTR retrotransposons.
Product Categories/Family for anti-APOBEC3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47 kDa
NCBI Official Full Name
DNA dC->dU-editing enzyme APOBEC-3 isoform X1
NCBI Official Synonym Full Names
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 3
NCBI Official Symbol
Apobec3
NCBI Official Synonym Symbols
Arp3; Rfv3; Cem15; Apobec; Gm20117; BC003314
NCBI Protein Information
DNA dC->dU-editing enzyme APOBEC-3
UniProt Protein Name
DNA dC->dU-editing enzyme APOBEC-3
UniProt Gene Name
Apobec3
UniProt Synonym Gene Names
Arp3; CEM15
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The APOBEC3 apobec3 (Catalog #AAA201624) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOBEC3 Antibody - middle region reacts with Tested: Mouse Predicted: Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's APOBEC3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the APOBEC3 apobec3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQVAAMDLYE FKKCWKKFVD NGGRRFRPWK RLLTNFRYQD SKLQEILRPC. It is sometimes possible for the material contained within the vial of "APOBEC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
