WB (Western Blot)
(WB Suggested Anti-APOBEC3G Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Daudi cell lysate)
Rabbit anti-Human, Pig APOBEC3G Polyclonal Antibody | anti-APOBEC3G antibody
APOBEC3G antibody - N-terminal region
Gene Names
APOBEC3G; A3G; ARCD; ARP9; ARP-9; CEM15; CEM-15; MDS019; bK150C2.7; dJ494G10.1
Reactivity
Human, Pig
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
APOBEC3G, Antibody; APOBEC3G antibody - N-terminal region; anti-APOBEC3G antibody
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
Sequence Length
384
Applicable Applications for anti-APOBEC3G antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-APOBEC3G Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Daudi cell lysate)
WB (Western Blot)
(WB Suggested Anti-APOBEC3G Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Daudi cell lysate)
IHC (Immunohiostchemistry)
(Rabbit Anti-ASGR2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Plasma membrane in endothelial cells in lymphatic vesselPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohiostchemistry)
(Rabbit Anti-ASGR2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Plasma membrane in endothelial cells in lymphatic vesselPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Human Stomach)
IHC (Immunohistochemistry)
(Human Stomach)
Related Product Information for anti-APOBEC3G antibody
This is a rabbit polyclonal antibody against APOBEC3G. It was validated on Western Blot and immunohistochemistry
Target Description: APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity.
Target Description: APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity.
Product Categories/Family for anti-APOBEC3G antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
DNA dC->dU-editing enzyme APOBEC-3G isoform 1
NCBI Official Synonym Full Names
apolipoprotein B mRNA editing enzyme catalytic subunit 3G
NCBI Official Symbol
APOBEC3G
NCBI Official Synonym Symbols
A3G; ARCD; ARP9; ARP-9; CEM15; CEM-15; MDS019; bK150C2.7; dJ494G10.1
NCBI Protein Information
DNA dC->dU-editing enzyme APOBEC-3G
UniProt Protein Name
DNA dC->dU-editing enzyme APOBEC-3G
UniProt Gene Name
APOBEC3G
UniProt Synonym Gene Names
APOBEC-related protein; ARCD; ARP-9; CEM15; A3G
UniProt Entry Name
ABC3G_HUMAN
Similar Products
Product Notes
The APOBEC3G apobec3g (Catalog #AAA197617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOBEC3G antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's APOBEC3G can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the APOBEC3G apobec3g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKIFRGQVYS ELKYHPEMRF FHWFSKWRKL HRDQEYEVTW YISWSPCTKC. It is sometimes possible for the material contained within the vial of "APOBEC3G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.