Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282294_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human stomach using APOD antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

Rabbit anti-Human APOD Polyclonal Antibody | anti-APOD antibody

APOD Rabbit pAb

Gene Names
COL11A1; STL2; COLL6; CO11A1
Reactivity
Human
Applications
Immunohistochemistry
Purity
Affinity purification
Synonyms
APOD, Antibody; APOD Rabbit pAb; APOD; anti-APOD antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
EKKKSNFKKKMRTVATKSKEKSKKFTPPKSEKFSSKKKKSYQASAKAKLGVKANIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEEFGPGVPAETDITETSING
Applicable Applications for anti-APOD antibody
IHC (Immunohistochemistry)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 21-189 of human APOD (NP_001638.1).
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human stomach using APOD antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282294_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human stomach using APOD antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human liver using APOD antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282294_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human liver using APOD antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
Related Product Information for anti-APOD antibody
This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. This glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
181,065 Da
NCBI Official Full Name
collagen alpha-1(XI) chain isoform E preproprotein
NCBI Official Synonym Full Names
collagen, type XI, alpha 1
NCBI Official Symbol
COL11A1
NCBI Official Synonym Symbols
STL2; COLL6; CO11A1
NCBI Protein Information
collagen alpha-1(XI) chain; collagen alpha-1(XI) chain; collagen XI, alpha-1 polypeptide
UniProt Protein Name
Collagen alpha-1(XI) chain
UniProt Gene Name
COL11A1
UniProt Synonym Gene Names
COLL6
UniProt Entry Name
COBA1_HUMAN

Similar Products

Product Notes

The APOD col11a1 (Catalog #AAA282294) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOD Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOD can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the APOD col11a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EKKKSNFKKK MRTVATKSKE KSKKFTPPKS EKFSSKKKKS YQASAKAKLG VKANIVDDFQ EYNYGTMESY QTEAPRHVSG TNEPNPVEEI FTEEYLTGED YDSQRKNSED TLYENKEIDG RDSDLLVDGD LGEYDFYEYK EYEDKPTSPP NEEFGPGVPA ETDITETSIN G. It is sometimes possible for the material contained within the vial of "APOD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.