Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281577_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using Apolipoprotein A2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit Apolipoprotein A2 Polyclonal Antibody | anti-APOA2 antibody

Apolipoprotein A2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
APOA2; apoAII; Apo-AII; ApoA-II
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
Apolipoprotein A2, Antibody; Apolipoprotein A2 Rabbit pAb; APOA2; Apo-AII; ApoA-II; apoAII; anti-APOA2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Applicable Applications for anti-APOA2 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A2 (NP_001634.1).
Cellular Location
Secreted
Positive Samples
Human plasma
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using Apolipoprotein A2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281577_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using Apolipoprotein A2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using Apolipoprotein A2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281577_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using Apolipoprotein A2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of human plasma, using Apolipoprotein A2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA281577_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of human plasma, using Apolipoprotein A2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-APOA2 antibody
Background: This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
336
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,175 Da
NCBI Official Full Name
apolipoprotein A-II preproprotein
NCBI Official Synonym Full Names
apolipoprotein A-II
NCBI Official Symbol
APOA2
NCBI Official Synonym Symbols
apoAII; Apo-AII; ApoA-II
NCBI Protein Information
apolipoprotein A-II; apolipoprotein A2
UniProt Protein Name
Apolipoprotein A-II
UniProt Gene Name
APOA2
UniProt Synonym Gene Names
Apo-AII; ApoA-II
UniProt Entry Name
APOA2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The APOA2 apoa2 (Catalog #AAA281577) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Apolipoprotein A2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Apolipoprotein A2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the APOA2 apoa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKLLAATVLL LTICSLEGAL VRRQAKEPCV ESLVSQYFQT VTDYGKDLME KVKSPELQAE AKSYFEKSKE QLTPLIKKAG TELVNFLSYF VELGTQPATQ. It is sometimes possible for the material contained within the vial of "Apolipoprotein A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.