Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46742_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of PC-3 cells using anti-APRT antibody (AAA46742).Overlay histogram showing PC-3 cells stained with AAA46742 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APRT Antibody (AAA46742,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit anti-Human APRT Polyclonal Antibody | anti-APRT antibody

Anti-APRT Antibody

Gene Names
APRT; AMP; APRTD
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
APRT, Antibody; Anti-APRT Antibody; AMP; AMP diphosphorylase; AMP pyrophosphorylase; APRT; APRTD; Transphosphoribosidase; P07741; Adenine phosphoribosyltransferase; anti-APRT antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
180
Applicable Applications for anti-APRT antibody
WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human APRT (5-49aa ELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARH), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of PC-3 cells using anti-APRT antibody (AAA46742).Overlay histogram showing PC-3 cells stained with AAA46742 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APRT Antibody (AAA46742,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46742_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of PC-3 cells using anti-APRT antibody (AAA46742).Overlay histogram showing PC-3 cells stained with AAA46742 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APRT Antibody (AAA46742,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 2. Flow Cytometry analysis of A549 cells using anti-APRT antibody (AAA46742).Overlay histogram showing A549 cells stained with AAA46742 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APRT Antibody (AAA46742,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46742_FCM13.jpg FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of A549 cells using anti-APRT antibody (AAA46742).Overlay histogram showing A549 cells stained with AAA46742 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APRT Antibody (AAA46742,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of APRT using anti-APRT antibody (AAA46742).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: K562 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-APRT antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for APRT at approximately 20KD. The expected band size for APRT is at 20KD.)

product-image-AAA46742_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of APRT using anti-APRT antibody (AAA46742).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: K562 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-APRT antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for APRT at approximately 20KD. The expected band size for APRT is at 20KD.)
Related Product Information for anti-APRT antibody
Rabbit IgG polyclonal antibody for Adenine phosphoribosyltransferase(APRT) detection.
Background: Adenine phosphoribosyltransferase (APRTase) is an enzyme encoded by the APRT gene, found in humans on chromosome 16. It belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2, 8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.
References
1. Silva CH, Silva M, Iulek J, Thiemann OH (Jun 2008). "Structural complexes of human adenine phosphoribosyltransferase reveal novel features of the APRT catalytic mechanism". Journal of Biomolecular Structure & Dynamics. 25 (6): 589-97.
2. Sarver AE, Wang CC (Oct 2002). "The adenine phosphoribosyltransferase from Giardia lamblia has a unique reaction mechanism and unusual substrate binding properties". The Journal of Biological Chemistry. 277(42): 39973-80.
3. Valaperta R, Rizzo V, Lombardi F, Verdelli C, Piccoli M, Ghiroldi A, Creo P, Colombo A, Valisi M, Margiotta E, Panella R, Costa E (1 July 2014). "Adenine phosphoribosyltransferase (APRT) deficiency: identification of a novel nonsense mutation". BMC Nephrology. 15: 102.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
353
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,557 Da
NCBI Official Full Name
adenine phosphoribosyltransferase isoform a
NCBI Official Synonym Full Names
adenine phosphoribosyltransferase
NCBI Official Symbol
APRT
NCBI Official Synonym Symbols
AMP; APRTD
NCBI Protein Information
adenine phosphoribosyltransferase
UniProt Protein Name
Adenine phosphoribosyltransferase
UniProt Gene Name
APRT
UniProt Synonym Gene Names
APRT

Similar Products

Product Notes

The APRT aprt (Catalog #AAA46742) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-APRT Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APRT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the APRT aprt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APRT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.