Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201560_WB13.jpg WB (Western Blot) (Host: RatTarget Name: AQP1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

Rabbit anti-Human AQP1 Polyclonal Antibody | anti-AQP1 antibody

AQP1 Antibody - C-terminal region

Gene Names
AQP1; CO; CHIP28; AQP-CHIP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
AQP1, Antibody; AQP1 Antibody - C-terminal region; anti-AQP1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: PFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVE
Sequence Length
269
Applicable Applications for anti-AQP1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human AQP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RatTarget Name: AQP1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

product-image-AAA201560_WB13.jpg WB (Western Blot) (Host: RatTarget Name: AQP1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: AQP1Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201560_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: AQP1Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-AQP1 antibody
Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). This gene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayer spanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant in erythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involving imbalance in ocular fluid movement. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-AQP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
358
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Synonym Full Names
aquaporin 1 (Colton blood group)
NCBI Official Symbol
AQP1
NCBI Official Synonym Symbols
CO; CHIP28; AQP-CHIP
NCBI Protein Information
aquaporin-1

Similar Products

Product Notes

The AQP1 (Catalog #AAA201560) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AQP1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AQP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AQP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFIGGALAVL IYDFILAPRS SDLTDRVKVW TSGQVEEYDL DADDINSRVE. It is sometimes possible for the material contained within the vial of "AQP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.