Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281629_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse kidney cells using AQP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit AQP2 Polyclonal Antibody | anti-AQP2 antibody

AQP2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
AQP2; AQP-CD; WCH-CD
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
AQP2, Antibody; AQP2 Rabbit pAb; AQP2; AQP-CD; WCH-CD; anti-AQP2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
ASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGTKA
Applicable Applications for anti-AQP2 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 147-271 of human AQP2 (NP_000477.1).
Cellular Location
Apical cell membrane, Basolateral cell membrane, Cytoplasmic vesicle membrane, Golgi apparatus, Multi-pass membrane protein, trans-Golgi network membrane
Positive Samples
293T, mouse kidney, rat kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of mouse kidney cells using AQP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281629_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse kidney cells using AQP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of rat kidney cells using AQP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281629_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat kidney cells using AQP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using AQP2 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281629_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using AQP2 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using AQP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA281629_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using AQP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-AQP2 antibody
Background: This gene encodes a water channel protein located in the kidney collecting tubule. It belongs to the MIP/aquaporin family, some members of which are clustered together on chromosome 12q13. Mutations in this gene have been linked to autosomal dominant and recessive forms of nephrogenic diabetes insipidus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
359
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,837 Da
NCBI Official Full Name
aquaporin-2
NCBI Official Synonym Full Names
aquaporin 2 (collecting duct)
NCBI Official Symbol
AQP2
NCBI Official Synonym Symbols
AQP-CD; WCH-CD
NCBI Protein Information
aquaporin-2; AQP-2; aquaporin-CD; ADH water channel; water-channel aquaporin 2; collecting duct water channel protein; water channel protein for renal collecting duct
UniProt Protein Name
Aquaporin-2
UniProt Gene Name
AQP2
UniProt Synonym Gene Names
AQP-2; AQP-CD
UniProt Entry Name
AQP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The AQP2 aqp2 (Catalog #AAA281629) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AQP2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AQP2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the AQP2 aqp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASTDERRGEN PGTPALSIGF SVALGHLLGI HYTGCSMNPA RSLAPAVVTG KFDDHWVFWI GPLVGAILGS LLYNYVLFPP AKSLSERLAV LKGLEPDTDW EEREVRRRQS VELHSPQSLP RGTKA. It is sometimes possible for the material contained within the vial of "AQP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.