Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199419_WB11.jpg WB (Western Blot) (WB Suggested Anti-Aqp2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)

Rabbit Aqp2 Polyclonal Antibody | anti-AQP2 antibody

Aqp2 antibody - middle region

Gene Names
Aqp2; cph; jpk; AQP-CD; WCH-CD
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purified
Synonyms
Aqp2, Antibody; Aqp2 antibody - middle region; anti-AQP2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV
Sequence Length
271
Applicable Applications for anti-AQP2 antibody
IF (Immunofluorescence), WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Aqp2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)

product-image-AAA199419_WB11.jpg WB (Western Blot) (WB Suggested Anti-Aqp2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)

IHC (Immunohiostchemistry)

(Rabbit Anti-AQP2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Kidney TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199419_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-AQP2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Kidney TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IF (Immunofluorescence)

(Mouse kidney)

product-image-AAA199419_IF15.jpg IF (Immunofluorescence) (Mouse kidney)
Related Product Information for anti-AQP2 antibody
This is a rabbit polyclonal antibody against Aqp2. It was validated on Western Blot

Target Description: Aqp2 forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Product Categories/Family for anti-AQP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
aquaporin-2
NCBI Official Synonym Full Names
aquaporin 2
NCBI Official Symbol
Aqp2
NCBI Official Synonym Symbols
cph; jpk; AQP-CD; WCH-CD
NCBI Protein Information
aquaporin-2
UniProt Protein Name
Aquaporin-2
UniProt Gene Name
Aqp2
UniProt Synonym Gene Names
AQP-2; AQP-CD
UniProt Entry Name
AQP2_MOUSE

Similar Products

Product Notes

The AQP2 aqp2 (Catalog #AAA199419) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Aqp2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Aqp2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the AQP2 aqp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALSIGFSVTL GHLLGIYFTG CSMNPARSLA PAVVTGKFDD HWVFWIGPLV. It is sometimes possible for the material contained within the vial of "Aqp2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.