Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46365_IHC10.jpg IHC (Immunohistochemistry) (Anti- Aquaporin 1 Picoband antibody, AAA46365, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

Aquaporin 1 Polyclonal Antibody | anti-AQP1 antibody

Anti-Aquaporin 1 Antibody

Average rating 0.0
No ratings yet
Gene Names
AQP1; CO; CHIP28; AQP-CHIP
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Aquaporin 1, Antibody; Anti-Aquaporin 1 Antibody; Aquaporin-1; AQP 1; AQP CHIP; AQP-1; AQP1; AQP1_HUMAN; Aquaporin CHIP; Aquaporin-CHIP; Aquaporin1; Channel forming integral protein 28kDa; Channel like integral membrane protein 28 kDa; CHIP 28; CHIP28; CO; Colton blood group; Growth factor induced delayed early response protein; MGC26324; Urine water channel; Water channel protein CHIP 29; Water channel protein CHIP29; Water channel protein for red blood cells and kidney proximal tubule; aquaporin 1; anti-AQP1 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
186
Applicable Applications for anti-AQP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Aquaporin 1 Picoband antibody, AAA46365, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

product-image-AAA46365_IHC10.jpg IHC (Immunohistochemistry) (Anti- Aquaporin 1 Picoband antibody, AAA46365, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- Aquaporin 1 Picoband antibody, AAA46365, IHC(P)IHC(P): Rat Kidney Tissue)

product-image-AAA46365_IHC11.jpg IHC (Immunohistochemisry) (Anti- Aquaporin 1 Picoband antibody, AAA46365, IHC(P)IHC(P): Rat Kidney Tissue)

IHC (Immunohiostchemistry)

(Anti- Aquaporin 1 Picoband antibody, AAA46365, IHC(P)IHC(P): Mouse Kidney Tissue)

product-image-AAA46365_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Aquaporin 1 Picoband antibody, AAA46365, IHC(P)IHC(P): Mouse Kidney Tissue)

WB (Western Blot)

(Anti- Aquaporin 1 Picoband antibody, AAA46365, Western blottingAll lanes: Anti Aquaporin 1 (AAA46365) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: Rat Cardiac Muscle Tissue Lysate at 50ugLane 4: PC-12 Whole Cell Lysate at 40ugLane 5: HEPA Whole Cell Lysate at 40ugPredicted bind size: 29KDObserved bind size: 29KD)

product-image-AAA46365_WB15.jpg WB (Western Blot) (Anti- Aquaporin 1 Picoband antibody, AAA46365, Western blottingAll lanes: Anti Aquaporin 1 (AAA46365) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: Rat Cardiac Muscle Tissue Lysate at 50ugLane 4: PC-12 Whole Cell Lysate at 40ugLane 5: HEPA Whole Cell Lysate at 40ugPredicted bind size: 29KDObserved bind size: 29KD)
Related Product Information for anti-AQP1 antibody
Description: Rabbit IgG polyclonal antibody for Aquaporin-1(AQP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
References
1. Denker, B. M.; Smith, B. L.; Kuhajda, F. P.; Agre, P. : Identification, purification, and partial characterization of a novel M(r) 28,000 integral membrane protein from erythrocytes and renal tubules. J. Biol. Chem. 263: 15634-15642, 1988. 2. Thiagarajah, J. R.; Verkman, A. S. : Aquaporin deletion in mice reduces corneal water permeability and delays restoration of transparency after swelling. J. Biol. Chem. 277: 19139-19144, 2002.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
358
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,677 Da
NCBI Official Full Name
aquaporin-1 isoform 2
NCBI Official Synonym Full Names
aquaporin 1 (Colton blood group)
NCBI Official Symbol
AQP1
NCBI Official Synonym Symbols
CO; CHIP28; AQP-CHIP
NCBI Protein Information
aquaporin-1
UniProt Protein Name
Aquaporin-1
UniProt Gene Name
AQP1
UniProt Synonym Gene Names
CHIP28; AQP-1
UniProt Entry Name
AQP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The AQP1 aqp1 (Catalog #AAA46365) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Aquaporin 1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Aquaporin 1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the AQP1 aqp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Aquaporin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.