Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200122_WB11.jpg WB (Western Blot) (WB Suggested Anti-ARID5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateARID5A is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit ARID5A Polyclonal Antibody | anti-ARID5A antibody

ARID5A antibody - C-terminal region

Gene Names
ARID5A; MRF1; MRF-1; RP11-363D14
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ARID5A, Antibody; ARID5A antibody - C-terminal region; anti-ARID5A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL
Sequence Length
594
Applicable Applications for anti-ARID5A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 80%; Dog: 100%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ARID5A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ARID5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateARID5A is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA200122_WB11.jpg WB (Western Blot) (WB Suggested Anti-ARID5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateARID5A is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: ARID5ASample Tissue: Human 721_BAntibody Dilution: 1.0ug/ml)

product-image-AAA200122_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ARID5ASample Tissue: Human 721_BAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-ARID5A antibody)

product-image-AAA200122_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-ARID5A antibody)
Related Product Information for anti-ARID5A antibody
This is a rabbit polyclonal antibody against ARID5A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth.Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 [PubMed 15640446]).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
AT-rich interactive domain-containing protein 5A isoform c
NCBI Official Synonym Full Names
AT-rich interaction domain 5A
NCBI Official Symbol
ARID5A
NCBI Official Synonym Symbols
MRF1; MRF-1; RP11-363D14
NCBI Protein Information
AT-rich interactive domain-containing protein 5A
UniProt Protein Name
AT-rich interactive domain-containing protein 5A
UniProt Gene Name
ARID5A
UniProt Synonym Gene Names
MRF1; ARID domain-containing protein 5A; MRF-1
UniProt Entry Name
ARI5A_HUMAN

Similar Products

Product Notes

The ARID5A arid5a (Catalog #AAA200122) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARID5A antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARID5A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ARID5A arid5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAAGLMHFPP TSFDSALRHR LCPASSAWHA PPVTTYAAPH FFHLNTKL. It is sometimes possible for the material contained within the vial of "ARID5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.